Rv3352c Resolved · high auto-curated
H37Rv Rv3352c · MTBC0 - ·
123 aa · 3768222–3768593 (-) ·
RefSeq NP_217869.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | oxidoreductase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Oxidoreductase. Pfam: FAD_binding_4 (PF01565.29). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
O50381
TrEMBL · unreviewed
· Inferred from homology
|
|---|---|
| UniProt name | Possible oxidoreductase |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| eggNOG description | oxidoreductase |
| Orthologous group | COG0277 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
FAD_binding_4 | PF01565.29 | 4.6e-09 | 3–69 | FAD binding domain |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3351c hyp |
hypothetical protein | 883 | 883 ctx | neighborhood:605 fusion:556 |
Rv1551 plsB1 |
acyltransferase PlsB | 621 | 605 | database:549 |
Rv2482c plsB2 |
glycerol-3-phosphate acyltransferase | 619 | 602 | database:549 |
Rv3806c ubiA |
decaprenyl-phosphate phosphoribosyltransferase | 590 | 570 | database:552 |
Rv1310 atpD |
ATP synthase subunit beta | 571 | 555 | database:538 |
Rv1305 atpE |
ATP synthase subunit C | 536 | 537 | database:526 |
Rv3353c hyp |
hypothetical protein | 528 | 528 ctx | neighborhood:515 |
Rv3633 hyp |
hypothetical protein | 543 | 526 | database:463 |
Rv1501 hyp |
hypothetical protein | 543 | 526 | database:463 |
Rv0694 mftD |
mycofactocin system heme/flavin oxidoreductase MftD | 537 | 517 | |
Rv1872c lldD2 |
L-lactate dehydrogenase | 536 | 516 | |
Rv3029c fixA |
electron transfer flavoprotein subunit beta | 524 | 502 | |
Rv3028c fixB |
electron transfer flavoprotein subunit alpha | 521 | 497 | |
Rv3417c groEL1 |
chaperonin GroEL | 473 | 453 | |
Rv0440 groEL2 |
molecular chaperone GroEL | 472 | 453 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): oxidoreductase
- Pfam (hmmscan --cut_ga): FAD_binding_4 PF01565.29 (E=5e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217869.1)
- Domains: Pfam-A via hmmscan --cut_ga — FAD_binding_4 (PF01565.29)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0277 - Curated reference: UniProt O50381 (TrEMBL, unreviewed; Inferred from homology)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 39 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv3352c| MSAATDLYAVHQALAGESRAIPTGSCPTVGVAGLTLGGGLGADSRHAGLTCDALKSATVVLPGGDAVSASADDHAELFWALRGGGGGNFGVTTSMTFARFPTADCDVVRVDFAPSAAAQVLVG