Rv3352c Resolved · high auto-curated

H37Rv Rv3352c · MTBC0 - · 123 aa · 3768222–3768593 (-) · RefSeq NP_217869.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)oxidoreductase
MTBC0 PGAP re-annotation
Revised (this work)Oxidoreductase. Pfam: FAD_binding_4 (PF01565.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O50381 TrEMBL · unreviewed · Inferred from homology
UniProt namePossible oxidoreductase

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
eggNOG descriptionoxidoreductase
Orthologous groupCOG0277

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
FAD_binding_4PF01565.29 4.6e-093–69 FAD binding domain

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv3351c hyp hypothetical protein 883 883 ctx neighborhood:605 fusion:556
Rv1551 plsB1 acyltransferase PlsB 621 605 database:549
Rv2482c plsB2 glycerol-3-phosphate acyltransferase 619 602 database:549
Rv3806c ubiA decaprenyl-phosphate phosphoribosyltransferase 590 570 database:552
Rv1310 atpD ATP synthase subunit beta 571 555 database:538
Rv1305 atpE ATP synthase subunit C 536 537 database:526
Rv3353c hyp hypothetical protein 528 528 ctx neighborhood:515
Rv3633 hyp hypothetical protein 543 526 database:463
Rv1501 hyp hypothetical protein 543 526 database:463
Rv0694 mftD mycofactocin system heme/flavin oxidoreductase MftD 537 517
Rv1872c lldD2 L-lactate dehydrogenase 536 516
Rv3029c fixA electron transfer flavoprotein subunit beta 524 502
Rv3028c fixB electron transfer flavoprotein subunit alpha 521 497
Rv3417c groEL1 chaperonin GroEL 473 453
Rv0440 groEL2 molecular chaperone GroEL 472 453

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): oxidoreductase
  • Pfam (hmmscan --cut_ga): FAD_binding_4 PF01565.29 (E=5e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217869.1)
  • Domains: Pfam-A via hmmscan --cut_ga — FAD_binding_4 (PF01565.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0277
  • Curated reference: UniProt O50381 (TrEMBL, unreviewed; Inferred from homology)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 39 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv3352c|
MSAATDLYAVHQALAGESRAIPTGSCPTVGVAGLTLGGGLGADSRHAGLTCDALKSATVVLPGGDAVSASADDHAELFWALRGGGGGNFGVTTSMTFARFPTADCDVVRVDFAPSAAAQVLVG