Rv3000 Family assigned · medium auto-curated

H37Rv Rv3000 · MTBC0 mtbc0_003189 · 219 aa · 3379921–3380580 (+) · RefSeq NP_217516.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationABC transporter permease
Revised (this work)ABC transporter permease. Pfam: ABC_tran (PF00005.34), UPF0014 (PF03649.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt I6X5Z8 TrEMBL · unreviewed · Inferred from homology
UniProt namePossible conserved transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category V Defense mechanisms
eggNOG descriptiontransport system permease
Orthologous groupCOG0390
KEGG orthology K02069
KEGG modules M00211

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.821 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 6 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.17% of strains (249) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ABC_tranPF00005.34 2.9e-1421–122 ABC transporter
UPF0014PF03649.19 1.2e-31112–203 Uncharacterised protein family (UPF0014)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lppY (lipoprotein LppY), medium confidence from genomic context alone (score 681 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2999 lppY lipoprotein LppY 681 681 ctx neighborhood:634
Rv0986 adhesion component ABC transporter ATP-binding protein 615 616 ctx cooccurence:572
Rv2564 glnQ glutamine ABC transporter ATP-binding protein 597 598 ctx cooccurence:525
Rv0073 glutamine ABC transporter ATP-binding protein 542 542 ctx cooccurence:463
Rv3314c deoA thymidine phosphorylase 522 523 ctx neighborhood:520
Rv3313c add adenosine deaminase 521 522 ctx neighborhood:520
Rv3315c cdd cytidine deaminase 520 520 ctx neighborhood:520
Rv3383c idsB polyprenyl synthetase IdsB 483 483 ctx cooccurence:483
Rv2998A Rv2998A, len: 67 aa. Probable conserved hypothetical protein, (possibly gene fragment), highly similar to central part of two-component sens 450 450 ctx neighborhood:443
Rv3398c idsA1 multifunctional dimethylallyltransferase/geranyltranstransferase/farnesyltranstransferase 449 450 ctx cooccurence:448
Rv0350 dnaK chaperone protein DnaK 449 450 ctx cooccurence:448
Rv2373c dnaJ2 chaperone protein DnaJ 448 449 ctx cooccurence:447
Rv1349 irtB iron ABC transporter ATP-binding protein/permease IrtB 468 448 ctx cooccurence:436
Rv0304c PPE5 PPE family protein PPE5 442 442 ctx cooccurence:442
Rv0355c PPE8 PPE family protein PPE8 438 438 ctx cooccurence:438

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: ABC transporter permease
  • Pfam (hmmscan --cut_ga): ABC_tran PF00005.34 (E=3e-14), UPF0014 PF03649.19 (E=1e-31)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217516.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ABC_tran (PF00005.34), UPF0014 (PF03649.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0390
  • Curated reference: UniProt I6X5Z8 (TrEMBL, unreviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 29 functional partner(s); context anchor lppY
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003189|Rv3000|
MAVHGFLLERVSVVRDEATVLRQVSAHFPAGRCSAVRGASGSGKTTLLRLLNRLIDPTSGKVWLDGVPLTDLDVLVLRRRVGLVAQAPVVLTDAVLNEVRVGRPDLPEGRVTELLARLCLGQSAREAFLPHQRSALRTALIPAIDSTKVVGLISLPGAMSGLILAGVDPLTAIRYQIVVMYLLLAATAVAALTCARLAERALFDRAHRLVSLPAATRRA