Rv0787A Family assigned · medium auto-curated
H37Rv Rv0787A · MTBC0 - ·
79 aa · 882524–882763 (+) ·
RefSeq YP_177755.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Contains PurS (PF02700.20) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
I6Y8S6
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Phosphoribosylformylglycinamidine synthase subunit PurS |
| EC (curated) |
EC 6.3.5.3
|
| Curated function | Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to Pur. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
F Nucleotide transport and metabolism
|
|---|---|
| Preferred name | purS |
| eggNOG description | Part of the phosphoribosylformylglycinamidine synthase complex involved in the purines biosynthetic pathway. Catalyzes the ATP-dependent conversion of formylglycinamide ribonucleotide (FGAR) and glutamine to yield formylglycinamidine ribonucleotide (FGAM) and glutamate. The FGAM synthase complex is composed of three subunits. PurQ produces an ammonia molecule by converting glutamine to glutamate. PurL transfers the ammonia molecule to FGAR to form FGAM in an ATP-dependent manner. PurS interacts with PurQ and PurL and is thought to assist in the transfer of the ammonia molecule from PurQ to PurL |
| Orthologous group | COG1828 |
| EC number |
EC 6.3.5.3
|
| KEGG orthology |
K01952
|
| KEGG pathways |
map00230, map01100, map01110, map01130
|
| KEGG modules |
M00048
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PurS | PF02700.20 | 4.0e-24 | 4–74 | Phosphoribosylformylglycinamidine (FGAM) synthase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: purQ (phosphoribosylformylglycinamidine synthase), high confidence from genomic context alone (score 1000 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0788 purQ |
phosphoribosylformylglycinamidine synthase | 999 | 1000 ctx | neighborhood:882 cooccurence:764 coexpression:863 experimental:790 database:900 textmining:590 |
Rv0803 purL |
phosphoribosylformylglycinamidine synthase 2 | 999 | 999 ctx | cooccurence:767 coexpression:858 experimental:790 database:900 textmining:417 |
Rv0809 purM |
phosphoribosylformylglycinamidine cyclo-ligase PurM | 991 | 989 | coexpression:857 database:900 |
Rv0956 purN |
phosphoribosylglycinamide formyltransferase PurN | 993 | 986 | coexpression:843 database:900 textmining:576 |
Rv0389 purT |
phosphoribosylglycinamide formyltransferase PurT | 929 | 908 | database:900 |
Rv0808 purF |
amidophosphoribosyltransferase | 910 | 894 | coexpression:858 |
Rv0772 purD |
phosphoribosylamine--glycine ligase | 913 | 886 | coexpression:850 |
Rv0780 purC |
phosphoribosylaminoimidazole-succinocarboxamide synthase | 910 | 883 | coexpression:857 |
Rv3276c purK |
5-(carboxyamino)imidazole ribonucleotide synthase | 911 | 879 | coexpression:840 |
Rv0957 purH |
bifunctional phosphoribosylaminoimidazolecarboxamide formyltransferase/inosinemonophosphate cyclohydrolase | 888 | 871 | coexpression:856 |
Rv3275c purE |
5-(carboxyamino)imidazole ribonucleotide mutase | 886 | 865 | coexpression:854 |
Rv0777 purB |
adenylosuccinate lyase PurB | 870 | 830 | coexpression:778 |
Rv0787 hyp |
hypothetical protein | 770 | 770 ctx | neighborhood:769 |
Rv0786c hyp |
hypothetical protein | 714 | 714 ctx | neighborhood:713 |
Rv0357c purA |
adenylosuccinate synthetase | 608 | 489 | coexpression:425 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): PurS PF02700.20 (E=4e-24)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177755.1)
- Domains: Pfam-A via hmmscan --cut_ga — PurS (PF02700.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1828 - Curated reference: UniProt I6Y8S6 (TrEMBL, unreviewed; Evidence at protein level)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
32 functional partner(s); context anchor
purQ - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0787A| MARVVVHVMPKAEILDPQGQAIVGALGRLGHLGISDVRQGKRFELEVDDTVDDTTLAEIAESLLANTVIEDWTISRDPQ