Rv3259 Family assigned · medium auto-curated

H37Rv Rv3259 · MTBC0 mtbc0_003467 · 139 aa · 3661568–3661987 (+) · RefSeq NP_217776.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationmetallopeptidase family protein
Revised (this work)Metallopeptidase family protein. Pfam: Zincin_1 (PF06262.18).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53352 TrEMBL · unreviewed · Evidence at protein level
UniProt nameExonuclease

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionZincin-like metallopeptidase
Orthologous groupCOG3824

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.689 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Zincin_1PF06262.18 1.6e-0741–134 Zincin-like metallopeptidase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pmmA (phosphomannomutase PmmA), high confidence from genomic context alone (score 704 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3258c hyp hypothetical protein 806 806 ctx neighborhood:777
Rv3257c pmmA phosphomannomutase PmmA 704 704 ctx neighborhood:658
Rv3256c hyp hypothetical protein 698 698 ctx neighborhood:554
Rv1417 membrane protein 675 675 ctx cooccurence:674
Rv3231c hyp hypothetical protein 651 651 ctx cooccurence:650
Rv0011c crgA cell division protein CrgA 613 613 ctx cooccurence:611
Rv2413c hyp hypothetical protein 598 598 ctx cooccurence:598
Rv3605c hyp hypothetical protein 595 595 ctx cooccurence:595
Rv2170 GCN5-like N-acetyltransferase 591 591 ctx cooccurence:591
Rv2119 hyp hypothetical protein 582 582 ctx cooccurence:582
Rv3669 transmembrane protein 567 568 ctx cooccurence:546
Rv3255c manA mannose-6-phosphate isomerase 554 554 ctx neighborhood:552
Rv3311 hyp hypothetical protein 544 545 ctx cooccurence:542
Rv0948c chorismate mutase 535 535 ctx cooccurence:534
Rv2050 rbpA RNA polymerase-binding protein RbpA 521 521 ctx cooccurence:516

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: metallopeptidase family protein
  • Pfam (hmmscan --cut_ga): Zincin_1 PF06262.18 (E=2e-07)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217776.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Zincin_1 (PF06262.18)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3824
  • Curated reference: UniProt O53352 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor pmmA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003467|Rv3259|
MRGPLLPPTVPGWRSRAERFDMAVLEAYEPIERRWQERVSQLDIAVDEIPRIAAKDPESVQWPPEVIADGPIALARLIPAGVDVRGNATRARIVLFRKPIERRAKDTEELGELLHEILVAQVAIYLDVDPSVIDPTIDD