rubA Resolved · high auto-curated

H37Rv Rv3251c · MTBC0 mtbc0_003459 · 55 aa · 3652714–3652881 (-) · RefSeq NP_217768.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)rubredoxin RubA
MTBC0 PGAP re-annotationrubredoxin
Revised (this work)Rubredoxin. Pfam: Rubredoxin (PF00301.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O05894 TrEMBL · unreviewed · Inferred from homology
UniProt nameRubredoxin
Curated functionInvolved in the hydrocarbon hydroxylating system, which transfers electrons from NADH to rubredoxin reductase and then through rubredoxin to alkane 1 monooxygenase.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred namerubA
eggNOG descriptionBelongs to the rubredoxin family
Orthologous groupCOG1773

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RubredoxinPF00301.26 3.8e-204–50 Rubredoxin

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: alkB (transmembrane alkane 1-monooxygenase AlkB), high confidence from genomic context alone (score 989 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3252c alkB transmembrane alkane 1-monooxygenase AlkB 990 989 ctx neighborhood:881 coexpression:856
Rv3250c rubB rubredoxin RubB 960 958 ctx neighborhood:816 coexpression:759
Rv3249c TetR family transcriptional regulator 864 865 ctx neighborhood:830
Rv1869c reductase 747 732 coexpression:410 experimental:549
Rv0688 ferredoxin reductase 746 730 coexpression:407 experimental:549
Rv0252 nirB nitrite reductase large subunit NirB 745 729 coexpression:404 experimental:549
Rv3248c sahH adenosylhomocysteinase 583 584 ctx neighborhood:581
Rv3253c cationic amino acid transport integral membrane protein 576 576 ctx neighborhood:575
Rv3841 bfrB bacterioferritin BfrB 473 447 coexpression:415
Rv2428 ahpC alkyl hydroperoxide reductase subunit AhpC 483 414
Rv3247c tmk thymidylate kinase 409 409 ctx neighborhood:409
Rv3254 hyp hypothetical protein 408 386
Rv2359 zur zinc uptake regulation protein 409 374
Rv1909c furA ferric uptake regulation protein FurA 408 373
Rv3554 fdxB electron transfer protein FdxB 454 134

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: rubredoxin RubA
  • MTBC0 PGAP product: rubredoxin
  • Pfam (hmmscan --cut_ga): Rubredoxin PF00301.26 (E=4e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217768.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rubredoxin (PF00301.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1773
  • Curated reference: UniProt O05894 (TrEMBL, unreviewed; Inferred from homology)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 22 functional partner(s); context anchor alkB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003459|Rv3251c|rubA
MAAYRCPVCDYVYDEANGDAREGFPAGTGWDQIPDDWCCPDCAVREKVDFEKIGG