Rv2119 Family assigned · medium auto-curated

H37Rv Rv2119 · MTBC0 mtbc0_002251 · 278 aa · 2405649–2406485 (+) · RefSeq NP_216635.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationRecB family exonuclease
Revised (this work)RecB family exonuclease. Pfam: PDDEXK_1 (PF12705.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O33254 TrEMBL · unreviewed · Evidence at protein level
UniProt namePD-(D/E)XK endonuclease-like domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category L Replication, recombination and repair
Preferred namerecB
eggNOG descriptionRecB family
Orthologous groupCOG2887
KEGG orthology K07465

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.528 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PDDEXK_1PF12705.14 6.1e-4014–260 PD-(D/E)XK nuclease superfamily

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: trmI (tRNA (adenine(58)-N(1))-methyltransferase), high confidence from genomic context alone (score 786 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2118c trmI tRNA (adenine(58)-N(1))-methyltransferase 785 786 ctx neighborhood:785
Rv3202c adnA ATP-dependent DNA helicase 585 586
Rv3259 hyp hypothetical protein 582 582 ctx cooccurence:582
Rv3416 whiB3 redox-responsive transcriptional regulator WhiB3 551 551 ctx cooccurence:550
Rv0949 uvrD1 ATP-dependent DNA helicase UvrD 548 481
Rv3662c hyp hypothetical protein 478 479 ctx cooccurence:460
Rv2610c pimA alpha-(1-2)-phosphatidylinositol mannosyltransferase 456 457 ctx cooccurence:455
Rv0058 dnaB replicative DNA helicase 484 456 coexpression:409
Rv2097c pafA proteasome accessory factor PafA 477 443
Rv2028c universal stress protein 438 438 ctx cooccurence:438
Rv3198c uvrD2 ATP-dependent DNA helicase UvrD 417 418
Rv3363c hyp hypothetical protein 416 417 ctx cooccurence:415
Rv2112c dop pup deamidase/depupylase 436 415
Rv2593c ruvA Holliday junction ATP-dependent DNA helicase RuvA 500 409 coexpression:409
Rv2594c ruvC crossover junction endodeoxyribonuclease RuvC 403 266

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: RecB family exonuclease
  • Pfam (hmmscan --cut_ga): PDDEXK_1 PF12705.14 (E=6e-40)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216635.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PDDEXK_1 (PF12705.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2887
  • Curated reference: UniProt O33254 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 19 functional partner(s); context anchor trmI
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002251|Rv2119|
MADQPDPPTPRPALSPSRATDFKQCPLLYRFRAIDRLPEATSAAQLRGSVVHAALEQLYGLPAGLRSPDTARSLVQRAWDQMVAAEPELAGELDPGQPTQLLEDARALVSGYYRLEDPTRFDPQCCEQRVEVELADGTLLRGYIDRIDVAATGELRVVDYKTGKAPPAARALAEFKAMFQMKFYAVALFRSRGVPPTRLRLIYLADGQLLDYSPDRDELLRFEKTLMAIWRAIQSAGETGDFRPNPSRLCDWCPHQQRCPAFGGTPPPYPGWPTEPAA