tmk Resolved · high auto-curated

H37Rv Rv3247c · MTBC0 mtbc0_003455 · 216 aa · 3649562–3650212 (-) · RefSeq NP_217764.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)thymidylate kinase
MTBC0 PGAP re-annotationdTMP kinase
Revised (this work)DTMP kinase. Pfam: Thymidylate_kin (PF02223.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKE1 SwissProt · reviewed · Evidence at protein level
UniProt nameThymidylate kinase
EC (curated) EC 2.7.4.9
Curated functionCatalyzes the reversible phosphorylation of deoxythymidine monophosphate (dTMP) to deoxythymidine diphosphate (dTDP), using ATP as its preferred phosphoryl donor. Situated at the junction of both de novo and salvage pathways of deoxythymidine triphosphate (dTTP) synthesis, is essential for DNA synthesis and cellular growth. Has a broad specificity for nucleoside triphosphates, being highly active with ATP or dATP as phosphate donors, and less active with ITP, GTP, CTP and UTP.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred nametmk
eggNOG descriptionPhosphorylation of dTMP to form dTDP in both de novo and salvage pathways of dTTP synthesis
Orthologous groupCOG0125
EC number EC 2.7.4.9
KEGG orthology K00943
KEGG pathways map00240, map01100
KEGG modules M00053
Gene Ontology (125) GO:0000166, GO:0000287, GO:0001882, GO:0001883, GO:0003674, GO:0003824, GO:0004798, GO:0005488, GO:0005515, GO:0005524, GO:0005525, GO:0005575 +113 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.55 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Thymidylate_kinPF02223.24 1.3e-217–189 Thymidylate kinase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mtrA (two component DNA-binding response regulator MtrA), high confidence from genomic context alone (score 794 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2697c dut deoxyuridine 5'-triphosphate nucleotidohydrolase 949 929 database:900
Rv3051c nrdE ribonucleoside-diphosphate reductase subunit alpha 943 923 database:900
Rv0570 nrdZ vitamin B12-dependent ribonucleoside-diphosphate reductase 932 923 database:900
Rv2754c thyX thymidylate synthase ThyX 932 921 database:900
Rv2764c thyA thymidylate synthase ThyA 940 918 database:900
Rv2445c ndkA nucleoside diphosphate kinase 927 906 database:900
Rv0233 nrdB ribonucleoside-diphosphate reductase subunit beta NrdB 913 904 database:900
Rv1981c nrdF1 ribonucleoside-diphosphate reductase subunit beta NrdF1 913 904 database:900
Rv3048c nrdF2 ribonucleoside-diphosphate reductase subunit beta NrdF2 913 904 database:900
Rv3246c mtrA two component DNA-binding response regulator MtrA 794 794 ctx neighborhood:794
Rv3248c sahH adenosylhomocysteinase 801 778 ctx neighborhood:775
Rv3244c lpqB lipoprotein LpqB 748 749 ctx neighborhood:748
Rv3249c TetR family transcriptional regulator 703 703 ctx neighborhood:703
Rv3438 hyp hypothetical protein 662 663 ctx cooccurence:661
Rv3311 hyp hypothetical protein 618 618 ctx cooccurence:618

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: thymidylate kinase
  • MTBC0 PGAP product: dTMP kinase
  • Pfam (hmmscan --cut_ga): Thymidylate_kin PF02223.24 (E=1e-21)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217764.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Thymidylate_kin (PF02223.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0125
  • Curated reference: UniProt P9WKE1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 70 functional partner(s); context anchor mtrA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003455|Rv3247c|tmk
MAVLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS