tmk Resolved · high auto-curated

H37Rv Rv3247c · MTBC0 mtbc0_003455 · 216 aa · 3649562–3650212 MTBC0 (-) · RefSeq NP_217764.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)thymidylate kinase
MTBC0 PGAP re-annotationdTMP kinase
Revised (this work)DTMP kinase. Pfam: Thymidylate_kin (PF02223.24).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 8 publications

8 TB publications mention this gene. 8 publication(s) discuss this gene (8 in a M. tuberculosis context).

Most recent 5 of 8.
PublicationDate
Improved Inhibitors Targeting the Thymidylate Kinase of Multidrug-Resistant Mycobacterium tuberculosis with Favorable Pharmacokinetics. doi:10.3390/life15020173 2025
Identification of mycobacterial Thymidylate kinase inhibitors: a comprehensive pharmacophore, machine learning, molecular docking, and molecular dynamics simulation studies. doi:10.1007/s11030-024-10967-w 2024
RepTB: a gene ontology based drug repurposing approach for tuberculosis. doi:10.1186/s13321-018-0276-9 2018
Structure based drug discovery for designing leads for the non-toxic metabolic targets in multi drug resistant Mycobacterium tuberculosis. doi:10.1186/s12967-017-1363-9 2017
Structure guided lead generation for M. tuberculosis thymidylate kinase (Mtb TMK): discovery of 3-cyanopyridone and 1,6-naphthyridin-2-one as potent inhibitors. doi:10.1021/jm5012947 2015

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

CRISPRi vulnerability

Vulnerability index -6.48 (95% CI -7.46 to -5.57). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionPhosphorylation of dTMP to form dTDP in both de novo and salvage pathways of dTTP synthesis [catalytic activity: ATP + thymidine 5'-phosphate = ADP + thymidine 5'-diphosphate].
Mycobrowser EC 2.7.4.9 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3275c · 99.5% identity
M. leprae ML0772 · 77.8% identity
M. marinum MMAR_1298 · 79.8% identity
M. smegmatis MSMEG_1873 · 65.4% identity
M. orygis RJtmp_003347 · 99.5% identity
M. abscessus MAB_3594c · 60.7% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WKE1 SwissProt · reviewed · Evidence at protein level
UniProt nameThymidylate kinase
EC (curated) EC 2.7.4.9
Curated functionCatalyzes the reversible phosphorylation of deoxythymidine monophosphate (dTMP) to deoxythymidine diphosphate (dTDP), using ATP as its preferred phosphoryl donor. Situated at the junction of both de novo and salvage pathways of deoxythymidine triphosphate (dTTP) synthesis, is essential for DNA synthesis and cellular growth. Has a broad specificity for nucleoside triphosphates, being highly active with ATP or dATP as phosphate donors, and less active with ITP, GTP, CTP and UTP.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred nametmk
eggNOG descriptionPhosphorylation of dTMP to form dTDP in both de novo and salvage pathways of dTTP synthesis
Orthologous groupCOG0125
EC number EC 2.7.4.9
KEGG orthology K00943
KEGG pathways map00240, map01100
KEGG modules M00053
Gene Ontology (125) GO:0000166, GO:0000287, GO:0001882, GO:0001883, GO:0003674, GO:0003824, GO:0004798, GO:0005488, GO:0005515, GO:0005524, GO:0005525, GO:0005575 +113 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.55 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

M. canettii dN/dS (deep-divergence selection) 0.368 (low power) · 6 consensus substitution(s)
low power (6 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 76.5% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 9/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 51.7%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis) essential

DeJesus 2017 callES · essential
What the call meansessential: insertions absent across the whole ORF
TA sites (Himar1) 10 in the ORF — 10 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.200, mean read count 1. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain

This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.

Hypomorph straintmk-FLAG-tetOn-1 (TetON promoter 1)
Baseline knockdown fitness2.901 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown
Used in target deconvolutionyes (informs phenotypic-cluster / MOA assignment)

Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.

Mutant phenotypes (conditional Tn-seq, MtbTnDB)

Conditionlog2FCqEffect
Differential genetic requirements of clinical Mtb strain (ID=631) from East Asian lineage (compared to H37Rv control) (strain background) +6.240.0 required
Differential genetic requirements of clinical Mtb strain (ID=621) from East Asian lineage (compared to H37Rv control) (strain background) +6.040.0 required
Differential genetic requirements of clinical Mtb strain (ID=662) from East Asian lineage (compared to H37Rv control) (strain background) +5.930.0 required
Differential genetic requirements of clinical Mtb strain (ID=632) from East Asian lineage (compared to H37Rv control) (strain background) +5.210.0 required
Differential genetic requirements of clinical Mtb strain (ID=641) from Indo-Oceanic lineage (compared to H37Rv control) (strain background) +5.040.0 required
Differential genetic requirements of clinical Mtb strain (ID=667) from Indo-Oceanic lineage (compared to H37Rv control) (strain background) +5.040.0 required
Differential genetic requirements of clinical Mtb strain (ID=663) from Euro-American lineage (compared to H37Rv control) (strain background) +1.540.011 required

Conditional fitness of transposon-disruption mutants across 7 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 12 of 16 independent MS datasets
Integrated abundance32.9 ppm · rank 2018/3519 (42.7th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length216 aa
Molecular weight22.8 kDa
Theoretical pI6.92
GRAVY-0.038 (hydrophilic)
Aliphatic index93.3
Aromaticity0.069
Instability index25.8 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Thymidylate_kinPF02223.24 1.3e-217–189 Thymidylate kinase

Experimental structures (Protein Data Bank) 21 solved

PDBMethodResolutionCoverage
1gtv X-ray diffraction 1.55 Å 100%
1gsi X-ray diffraction 1.6 Å 100%
1n5i X-ray diffraction 1.85 Å 100%
1n5j X-ray diffraction 1.85 Å 100%
6yt1 X-ray diffraction 1.9 Å 100%
1g3u X-ray diffraction 1.95 Å 100%
1mrs X-ray diffraction 2.0 Å 100%
1w2h X-ray diffraction 2.0 Å 100%

Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (21 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.4

PDB hitprobTM-scoreE-valueDescription
1g3u-assembly1_A 1.00 1.00 2.4e-36 sig 1g3u-assembly1_A CRYSTAL STRUCTURE OF MYCOBACTERIUM TUBERCULOSIS THYMIDYLATE KINASE COMPLEXED WITH THYMIDINE MONOPHOSPHATE (TMP)
1w2g-assembly1_B 1.00 0.99 2.6e-35 sig 1w2g-assembly1_B Crystal Structure Of Mycobacterium Tuberculosis Thymidylate Kinase Complexed With Deoxythymidine (dT) (2.1 A Resolution)
1n5l-assembly1_B 1.00 0.99 7.3e-35 sig 1n5l-assembly1_B CRYSTAL STRUCTURE OF MYCOBACTERIUM TUBERCULOSIS THYMIDYLATE KINASE CRYSTALLIZED IN SODIUM MALONATE, AFTER CATALYSIS IN THE CRYSTAL (2.3 A RESOLUTION)
1w2h-assembly1_B 1.00 0.99 4.5e-34 sig 1w2h-assembly1_B Crystal Structure Of Mycobacterium Tuberculosis Thymidylate Kinase Complexed With Azidothymidine Monophosphate (AZT-MP) (2.0 A Resolution)
1w2g-assembly1_A 1.00 0.98 2.5e-33 sig 1w2g-assembly1_A Crystal Structure Of Mycobacterium Tuberculosis Thymidylate Kinase Complexed With Deoxythymidine (dT) (2.1 A Resolution)

Foldseek search of the AlphaFold DB model (mean pLDDT 95.4, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)mtrA (- strand, 69 bp gap)
Downstream (3' on genome)sahH (- strand, 96 bp gap)

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: mtrA (two component DNA-binding response regulator MtrA), high confidence from genomic context alone (score 794 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2697c dut exp deoxyuridine 5'-triphosphate nucleotidohydrolase 949 929 database:900
Rv3051c nrdE exp ribonucleoside-diphosphate reductase subunit alpha 943 923 database:900
Rv0570 nrdZ exp vitamin B12-dependent ribonucleoside-diphosphate reductase 932 923 database:900
Rv2754c thyX exp thymidylate synthase ThyX 932 921 database:900
Rv2764c thyA exp thymidylate synthase ThyA 940 918 database:900
Rv2445c ndkA exp nucleoside diphosphate kinase 927 906 database:900
Rv0233 nrdB exp ribonucleoside-diphosphate reductase subunit beta NrdB 913 904 database:900
Rv1981c nrdF1 exp ribonucleoside-diphosphate reductase subunit beta NrdF1 913 904 database:900
Rv3048c nrdF2 exp ribonucleoside-diphosphate reductase subunit beta NrdF2 913 904 database:900
Rv3246c mtrA two component DNA-binding response regulator MtrA 794 794 ctx neighborhood:794
Rv3248c sahH adenosylhomocysteinase 801 778 ctx neighborhood:775
Rv3244c lpqB lipoprotein LpqB 748 749 ctx neighborhood:748
Rv3249c TetR family transcriptional regulator 703 703 ctx neighborhood:703
Rv3438 hyp hypothetical protein 662 663 ctx cooccurence:661
Rv3311 hyp hypothetical protein 618 618 ctx cooccurence:618

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: thymidylate kinase
  • MTBC0 PGAP product: dTMP kinase
  • Pfam (hmmscan --cut_ga): Thymidylate_kin PF02223.24 (E=1e-21)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217764.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Thymidylate_kin (PF02223.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0125
  • Curated reference: UniProt P9WKE1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.4)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 70 functional partner(s); context anchor mtrA
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003455|Rv3247c|tmk
MAVLIAIEGVDGAGKRTLVEKLSGAFRAAGRSVATLAFPRYGQSVAADIAAEALHGEHGDLASSVYAMATLFALDRAGAVHTIQGLCRGYDVVILDRYVASNAAYSAARLHENAAGKAAAWVQRIEFARLGLPKPDWQVLLAVSAELAGERSRGRAQRDPGRARDNYERDAELQQRTGAVYAELAAQGWGGRWLVVGADVDPGRLAATLAPPDVPS