Rv2267c Resolved · high auto-curated
H37Rv Rv2267c · MTBC0 mtbc0_002409 ·
388 aa · 2567749–2568915 (-) ·
RefSeq NP_216783.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | sulfotransferase |
| Revised (this work) | Sulfotransferase. Pfam: Sulfotransfer_1 (PF00685.34), Sulfotransfer_3 (PF13469.13). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WLG1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Omega-hydroxy-beta-dihydromenaquinone-9 sulfotransferase Stf3 |
| EC (curated) |
EC 2.8.2.40
|
| Curated function | Involved in the biosynthesis of sulfomenaquinone (SMK, initially named S881 on the basis of its mass), which is localized in the outer envelope of M.tuberculosis and negatively regulates its virulence. Catalyzes the transfer of a sulfonate group from 3'-phosphoadenosine-5'-phosphosulfate (PAPS) to omega-hydroxy-beta-dihydromenaquinone-9, generating omega-sulfo-beta-dihydromenaquinone-9 (sulfomenaquinone). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Sulfotransferase domain |
| Orthologous group | COG0446 |
| Gene Ontology (29) |
GO:0003674, GO:0003824, GO:0005575, GO:0006082, GO:0006629, GO:0006790, GO:0008146, GO:0008150, GO:0008152, GO:0008610, GO:0009058, GO:0009987 +17 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.513 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 5 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.22% of strains (320) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Sulfotransfer_1 | PF00685.34 | 2.2e-11 | 80–324 | Sulfotransferase domain |
Sulfotransfer_3 | PF13469.13 | 4.5e-37 | 82–324 | Sulfotransferase family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: cyp128 (cytochrome P450 Cyp128), high confidence from genomic context alone (score 986 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2268c cyp128 |
cytochrome P450 Cyp128 | 998 | 986 ctx | neighborhood:834 coexpression:821 database:500 textmining:875 |
Rv2299c htpG |
chaperone protein HtpG | 933 | 926 | experimental:786 database:631 |
Rv2555c alaS |
alanine--tRNA ligase | 925 | 919 | experimental:775 database:644 |
Rv3457c rpoA |
DNA-directed RNA polymerase subunit alpha | 878 | 870 | experimental:668 database:607 |
Rv0696 mftF |
mycofactocin biosynthesis glycosyltransferase MftF | 823 | 805 | experimental:788 |
Rv1390 rpoZ |
DNA-directed RNA polymerase subunit omega | 804 | 805 | experimental:515 database:594 |
Rv0667 rpoB |
DNA-directed RNA polymerase subunit beta | 810 | 790 | experimental:476 database:592 |
Rv2919c glnB |
nitrogen regulatory protein P-II | 806 | 788 | experimental:787 |
Rv0312 hyp |
hypothetical protein | 783 | 772 | experimental:455 database:567 |
Rv3446c hyp |
hypothetical protein | 783 | 771 | experimental:455 database:567 |
Rv2264c hyp |
hypothetical protein | 782 | 770 | experimental:455 database:567 |
Rv0350 dnaK |
chaperone protein DnaK | 781 | 769 | experimental:455 database:567 |
Rv2269c hyp |
hypothetical protein | 968 | 766 ctx | neighborhood:765 textmining:870 |
Rv2328 PE23 |
PE family protein PE23 | 817 | 766 | experimental:454 database:583 |
Rv3036c TB22.2 hyp |
hypothetical protein | 778 | 766 | experimental:454 database:583 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: sulfotransferase
- Pfam (hmmscan --cut_ga): Sulfotransfer_1 PF00685.34 (E=2e-11), Sulfotransfer_3 PF13469.13 (E=5e-37)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216783.1)
- Domains: Pfam-A via hmmscan --cut_ga — Sulfotransfer_1 (PF00685.34), Sulfotransfer_3 (PF13469.13)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0446 - Curated reference: UniProt P9WLG1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
127 functional partner(s); context anchor
cyp128 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002409|Rv2267c| MKALRSSSRLSRWREWAAPLWVGCNFSAWMRLLIRNRFAVHHSRWHFAVLYTFLSMVNSCLGLWQKIVFGRRVAETVIADPPIFIVGHWRTGTTLLHELLVVDDRHTGPTGYECLAPHHFLLTEWFAPYVEFLVSKHRAMDNMDLSLHHPQEDEFVWCMQGLPSPYLTIAFPNRPPQYEEYLDLEQVAPRELEIWKRTLFRFVQQVYFRRRKTVILKNPTHSFRIKVLLEVFPQAKFIHIVRDPYVVYPSTIHLHKALYRIHGLQQPTFDGLDDKVVSTYVDLYRKLDEGRELVDPTRFYELRYEDLIGDPEGQLRRLYQHLGLGDFECYLPRLRQYLADHADYKTNSYQLTVEQRAIVDEHWGEIIDRYGYDRHTPEPARLRPAVGG