Rv2910c Family assigned · medium auto-curated
H37Rv Rv2910c · MTBC0 - ·
147 aa · 3217827–3218270 (-) ·
RefSeq NP_217426.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Contains SnoaL_4 (PF13577.13) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WL25
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv2910c |
UniProt still lists this protein as Uncharacterized protein Rv2910c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| eggNOG description | SnoaL-like domain |
| Orthologous group | COG5517 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.861 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
SnoaL_4 | PF13577.13 | 5.7e-35 | 14–137 | SnoaL-like domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: dacB2 (penicillin-binding protein DacB2), medium confidence from genomic context alone (score 579 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1874 hyp |
hypothetical protein | 753 | 754 ctx | cooccurence:753 |
Rv0310c hyp |
hypothetical protein | 584 | 584 ctx | cooccurence:553 |
Rv2911 dacB2 |
penicillin-binding protein DacB2 | 580 | 579 ctx | neighborhood:579 |
Rv0293c hyp |
hypothetical protein | 531 | 532 ctx | cooccurence:524 |
Rv2908c hyp |
hypothetical protein | 525 | 525 ctx | neighborhood:524 |
Rv2909c rpsP |
30S ribosomal protein S16 | 525 | 525 ctx | neighborhood:524 |
Rv3551 |
CoA-transferase subunit alpha | 511 | 512 ctx | cooccurence:510 |
Rv3552 |
CoA-transferase subunit beta | 505 | 506 ctx | cooccurence:503 |
Rv3082c virS |
HTH-type transcriptional regulator VirS | 490 | 491 ctx | cooccurence:471 |
Rv1817 |
flavoprotein | 507 | 490 ctx | cooccurence:488 |
Rv2906c trmD |
tRNA (guanine-N1)-methyltransferase | 484 | 484 ctx | neighborhood:484 |
Rv2907c rimM |
16S rRNA processing protein RimM | 484 | 484 ctx | neighborhood:484 |
Rv2627c hyp |
hypothetical protein | 446 | 446 ctx | cooccurence:427 |
Rv3779 |
transmembrane protein | 437 | 438 ctx | cooccurence:436 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): SnoaL_4 PF13577.13 (E=6e-35)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217426.1)
- Domains: Pfam-A via hmmscan --cut_ga — SnoaL_4 (PF13577.13)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG5517 - Curated reference: UniProt P9WL25 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
14 functional partner(s); context anchor
dacB2 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2910c| MCAVLDRSMLSVAEISDRLEIQQLLVDYSSAIDQRRFDDLDRVFTPDAYIDYRALGGIDGRYPKIKQWLSQVLGNFPVYAHMLGNFSVRVDGDTASSRVICFNPMVFAGDRQQVLFCGLWYDDDFVRTPDGWRIIRRVETKCFQKMM