Rv2910c Family assigned · medium auto-curated

H37Rv Rv2910c · MTBC0 - · 147 aa · 3217827–3218270 (-) · RefSeq NP_217426.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotation
Revised (this work)Contains SnoaL_4 (PF13577.13) domain(s); putative function inferred from the domain architecture.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WL25 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv2910c

UniProt still lists this protein as Uncharacterized protein Rv2910c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
eggNOG descriptionSnoaL-like domain
Orthologous groupCOG5517

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.861 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
SnoaL_4PF13577.13 5.7e-3514–137 SnoaL-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: dacB2 (penicillin-binding protein DacB2), medium confidence from genomic context alone (score 579 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1874 hyp hypothetical protein 753 754 ctx cooccurence:753
Rv0310c hyp hypothetical protein 584 584 ctx cooccurence:553
Rv2911 dacB2 penicillin-binding protein DacB2 580 579 ctx neighborhood:579
Rv0293c hyp hypothetical protein 531 532 ctx cooccurence:524
Rv2908c hyp hypothetical protein 525 525 ctx neighborhood:524
Rv2909c rpsP 30S ribosomal protein S16 525 525 ctx neighborhood:524
Rv3551 CoA-transferase subunit alpha 511 512 ctx cooccurence:510
Rv3552 CoA-transferase subunit beta 505 506 ctx cooccurence:503
Rv3082c virS HTH-type transcriptional regulator VirS 490 491 ctx cooccurence:471
Rv1817 flavoprotein 507 490 ctx cooccurence:488
Rv2906c trmD tRNA (guanine-N1)-methyltransferase 484 484 ctx neighborhood:484
Rv2907c rimM 16S rRNA processing protein RimM 484 484 ctx neighborhood:484
Rv2627c hyp hypothetical protein 446 446 ctx cooccurence:427
Rv3779 transmembrane protein 437 438 ctx cooccurence:436

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
  • Pfam (hmmscan --cut_ga): SnoaL_4 PF13577.13 (E=6e-35)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217426.1)
  • Domains: Pfam-A via hmmscan --cut_ga — SnoaL_4 (PF13577.13)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG5517
  • Curated reference: UniProt P9WL25 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 14 functional partner(s); context anchor dacB2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2910c|
MCAVLDRSMLSVAEISDRLEIQQLLVDYSSAIDQRRFDDLDRVFTPDAYIDYRALGGIDGRYPKIKQWLSQVLGNFPVYAHMLGNFSVRVDGDTASSRVICFNPMVFAGDRQQVLFCGLWYDDDFVRTPDGWRIIRRVETKCFQKMM