rimM Resolved · high auto-curated

H37Rv Rv2907c · MTBC0 mtbc0_003089 · 176 aa · 3237190–3237720 (-) · RefSeq NP_217423.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)16S rRNA processing protein RimM
MTBC0 PGAP re-annotationribosome maturation factor RimM
Revised (this work)Ribosome maturation factor RimM. Pfam: RimM (PF01782.25), PRC (PF05239.22), PRC_RimM (PF24986.2).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WH19 SwissProt · reviewed · Evidence at protein level
UniProt nameRibosome maturation factor RimM
Curated functionAn accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred namerimM
eggNOG descriptionAn accessory protein needed during the final step in the assembly of 30S ribosomal subunit, possibly for assembly of the head region. Probably interacts with S19. Essential for efficient processing of 16S rRNA. May be needed both before and after RbfA during the maturation of 16S rRNA. It has affinity for free ribosomal 30S subunits but not for 70S ribosomes
Orthologous groupCOG0806
KEGG orthology K02860
Gene Ontology (2) GO:0008150, GO:0040007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.087 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RimMPF01782.25 1.1e-194–92 RimM N-terminal domain
PRCPF05239.22 5.9e-13101–173 PRC-barrel domain
PRC_RimMPF24986.2 2.0e-14106–172 RimM PRC barrel domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: trmD (tRNA (guanine-N1)-methyltransferase), high confidence from genomic context alone (score 985 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2906c trmD tRNA (guanine-N1)-methyltransferase 989 985 ctx neighborhood:882 coexpression:875
Rv2909c rpsP 30S ribosomal protein S16 979 973 ctx neighborhood:812 coexpression:863
Rv1307 atpH ATP synthase subunit b/delta 976 968 coexpression:962
Rv0705 rpsS 30S ribosomal protein S19 968 967 coexpression:778 experimental:857
Rv2908c hyp hypothetical protein 960 959 ctx neighborhood:872 coexpression:692
Rv2904c rplS 50S ribosomal protein L19 920 895 coexpression:853
Rv3443c rplM 50S ribosomal protein L13 880 871 coexpression:860
Rv2890c rpsB 30S ribosomal protein S2 897 867 coexpression:859
Rv0702 rplD 50S ribosomal protein L4 862 863 coexpression:863
Rv0053 rpsF 30S ribosomal protein S6 879 861 coexpression:861
Rv0641 rplA 50S ribosomal protein L1 859 860 coexpression:860
Rv0682 rpsL 30S ribosomal protein S12 871 857 coexpression:857
Rv0701 rplC 50S ribosomal protein L3 853 854 coexpression:854
Rv0651 rplJ 50S ribosomal protein L10 872 853 coexpression:817
Rv3458c rpsD 30S ribosomal protein S4 853 853 coexpression:853

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: 16S rRNA processing protein RimM
  • MTBC0 PGAP product: ribosome maturation factor RimM
  • Pfam (hmmscan --cut_ga): RimM PF01782.25 (E=1e-19), PRC PF05239.22 (E=6e-13), PRC_RimM PF24986.2 (E=2e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217423.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RimM (PF01782.25), PRC (PF05239.22), PRC_RimM (PF24986.2)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0806
  • Curated reference: UniProt P9WH19 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 123 functional partner(s); context anchor trmD
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003089|Rv2907c|rimM
MELVVGRVVKSHGVTGEVVVEIRTDDPADRFAPGTRLRAKGPFDGGAEGSAVSYVIESVRQHGGRLLVRLAGVADRDAADALRGSLFVIDADDLPPIDEPDTYYDHQLVGLMVQTATGEGVGVVTEVVHTAAGELLAVKRDSDEVLVPFVRAIVTSVSLDDGIVEIDPPHGLLNLE