viuB Resolved · high auto-curated

H37Rv Rv2895c · MTBC0 mtbc0_003077 · 283 aa · 3225210–3226061 (-) · RefSeq NP_217411.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)mycobactin utilization protein ViuB
MTBC0 PGAP re-annotationsiderophore-interacting protein
Revised (this work)Siderophore-interacting protein. Pfam: FAD_binding_9 (PF08021.18), SIP (PF04954.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WL31 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv2895c

UniProt still lists this protein as Uncharacterized protein Rv2895c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
Preferred nameviuB
eggNOG descriptionSiderophore-interacting protein
Orthologous groupCOG2375
Gene Ontology (55) GO:0003674, GO:0003824, GO:0005575, GO:0005623, GO:0005886, GO:0006810, GO:0006873, GO:0006875, GO:0006879, GO:0006950, GO:0007154, GO:0008150 +43 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.572 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
FAD_binding_9PF08021.18 2.1e-3510–127 Siderophore-interacting FAD-binding domain
SIPPF04954.19 9.4e-34134–262 Siderophore-interacting protein

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: xerC (tyrosine recombinase XerC), high confidence from genomic context alone (score 780 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2898c hyp hypothetical protein 837 837 ctx neighborhood:836
Rv2896c dprA hyp hypothetical protein 836 837 ctx neighborhood:836
Rv2897c hyp hypothetical protein 836 836 ctx neighborhood:836
Rv2894c xerC tyrosine recombinase XerC 780 780 ctx neighborhood:779
Rv2383c mbtB phenyloxazoline synthase 706 626 coexpression:455
Rv0265c iron ABC transporter substrate-binding lipoprotein 608 552
Rv2384 mbtA 2,3-dihydroxybenzoate-AMP ligase 601 493
Rv1057 hyp hypothetical protein 487 487 coexpression:401
Rv2900c fdhF formate dehydrogenase subunit alpha FdhF 480 480
Rv0318c integral membrane protein 441 442 coexpression:442
Rv1863c integral membrane protein 440 441 ctx cooccurence:439
Rv3846 sodA superoxide dismutase 412 413
Rv3524 membrane protein 408 406 coexpression:406
Rv1098c fum fumarate hydratase 426 404
Rv0931c pknD serine/threonine-protein kinase PknD 413 404 coexpression:404

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: mycobactin utilization protein ViuB
  • MTBC0 PGAP product: siderophore-interacting protein
  • Pfam (hmmscan --cut_ga): FAD_binding_9 PF08021.18 (E=2e-35), SIP PF04954.19 (E=9e-34)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217411.1)
  • Domains: Pfam-A via hmmscan --cut_ga — FAD_binding_9 (PF08021.18), SIP (PF04954.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2375
  • Curated reference: UniProt P9WL31 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 25 functional partner(s); context anchor xerC
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003077|Rv2895c|viuB
MAGRPLHAFEVVATRHLAPHMVRVVLGGSGFDTFVPSDFTDSYIKLVFVDDDVDVGRLPRPLTLDSFADLPTAKRPPVRTMTVRHVDAAAREIAVDIVLHGEHGVAGPWAAGAQRGQPIYLMGPGGAYAPDPAADWHLLAGDESAIPAIAAALEALPPDAIGRAFIEVAGPDDEIGLTAPDAVEVNWVYRGGRADLVPEDRAGDHAPLIEAVTTTAWLPGQVHVFIHGEAQAVMHNLRPYVRNERGVDAKWASSISGYWRRGRTEEMFRKWKKELAEAEAGTH