viuB Resolved · high auto-curated
H37Rv Rv2895c · MTBC0 mtbc0_003077 ·
283 aa · 3225210–3226061 (-) ·
RefSeq NP_217411.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | mycobactin utilization protein ViuB |
|---|---|
| MTBC0 PGAP re-annotation | siderophore-interacting protein |
| Revised (this work) | Siderophore-interacting protein. Pfam: FAD_binding_9 (PF08021.18), SIP (PF04954.19). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WL31
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv2895c |
UniProt still lists this protein as Uncharacterized protein Rv2895c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| Preferred name | viuB |
| eggNOG description | Siderophore-interacting protein |
| Orthologous group | COG2375 |
| Gene Ontology (55) |
GO:0003674, GO:0003824, GO:0005575, GO:0005623, GO:0005886, GO:0006810, GO:0006873, GO:0006875, GO:0006879, GO:0006950, GO:0007154, GO:0008150 +43 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.572 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 5 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
FAD_binding_9 | PF08021.18 | 2.1e-35 | 10–127 | Siderophore-interacting FAD-binding domain |
SIP | PF04954.19 | 9.4e-34 | 134–262 | Siderophore-interacting protein |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: xerC (tyrosine recombinase XerC), high confidence from genomic context alone (score 780 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2898c hyp |
hypothetical protein | 837 | 837 ctx | neighborhood:836 |
Rv2896c dprA hyp |
hypothetical protein | 836 | 837 ctx | neighborhood:836 |
Rv2897c hyp |
hypothetical protein | 836 | 836 ctx | neighborhood:836 |
Rv2894c xerC |
tyrosine recombinase XerC | 780 | 780 ctx | neighborhood:779 |
Rv2383c mbtB |
phenyloxazoline synthase | 706 | 626 | coexpression:455 |
Rv0265c |
iron ABC transporter substrate-binding lipoprotein | 608 | 552 | |
Rv2384 mbtA |
2,3-dihydroxybenzoate-AMP ligase | 601 | 493 | |
Rv1057 hyp |
hypothetical protein | 487 | 487 | coexpression:401 |
Rv2900c fdhF |
formate dehydrogenase subunit alpha FdhF | 480 | 480 | |
Rv0318c |
integral membrane protein | 441 | 442 | coexpression:442 |
Rv1863c |
integral membrane protein | 440 | 441 ctx | cooccurence:439 |
Rv3846 sodA |
superoxide dismutase | 412 | 413 | |
Rv3524 |
membrane protein | 408 | 406 | coexpression:406 |
Rv1098c fum |
fumarate hydratase | 426 | 404 | |
Rv0931c pknD |
serine/threonine-protein kinase PknD | 413 | 404 | coexpression:404 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: mycobactin utilization protein ViuB
- MTBC0 PGAP product: siderophore-interacting protein
- Pfam (hmmscan --cut_ga): FAD_binding_9 PF08021.18 (E=2e-35), SIP PF04954.19 (E=9e-34)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217411.1)
- Domains: Pfam-A via hmmscan --cut_ga — FAD_binding_9 (PF08021.18), SIP (PF04954.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2375 - Curated reference: UniProt P9WL31 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
25 functional partner(s); context anchor
xerC - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003077|Rv2895c|viuB MAGRPLHAFEVVATRHLAPHMVRVVLGGSGFDTFVPSDFTDSYIKLVFVDDDVDVGRLPRPLTLDSFADLPTAKRPPVRTMTVRHVDAAAREIAVDIVLHGEHGVAGPWAAGAQRGQPIYLMGPGGAYAPDPAADWHLLAGDESAIPAIAAALEALPPDAIGRAFIEVAGPDDEIGLTAPDAVEVNWVYRGGRADLVPEDRAGDHAPLIEAVTTTAWLPGQVHVFIHGEAQAVMHNLRPYVRNERGVDAKWASSISGYWRRGRTEEMFRKWKKELAEAEAGTH