Rv2980 Still unknown · low auto-curated

H37Rv Rv2980 · MTBC0 mtbc0_003165 · 181 aa · 3357133–3357678 (+) · RefSeq NP_217496.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF3515 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF3515. Function unknown. Foldseek best (non-significant) hit: 5y39-assembly1_B Crystal structure of Ragulator complex (p18 76-145) (prob 0.38, TM 0.58).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P95115 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible conserved secreted protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF3515)
Orthologous group2ECK0

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.396 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF3515PF12028.14 1.0e-5418–174 Protein of unknown function (DUF3515)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 95.6 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
5y39-assembly1_B 0.38 0.58 4.5e-01 5y39-assembly1_B Crystal structure of Ragulator complex (p18 76-145)
5x6u-assembly1_B 0.33 0.58 5.8e-01 5x6u-assembly1_B Crystal structure of human heteropentameric complex
5y3a-assembly1_B 0.28 0.59 7.8e-01 5y3a-assembly1_B Crystal structure of Ragulator complex (p18 49-161)
5y3a-assembly2_G 0.25 0.56 7.8e-01 5y3a-assembly2_G Crystal structure of Ragulator complex (p18 49-161)
6ehp-assembly1_B 0.20 0.58 1.3e+00 6ehp-assembly1_B The crystal structure of the human LAMTOR complex
8fw5-assembly1_D 0.20 0.55 1.2e+00 8fw5-assembly1_D Chimeric HsGATOR1-SpGtr-SpLam complex
5yk3-assembly2_B 0.18 0.50 8.7e-01 5yk3-assembly2_B human Ragulator complex
7yh1-assembly2_C 0.15 0.61 2.3e+00 7yh1-assembly2_C Roadblock from Candidatus Prometheoarchaeum syntrophicum strain MK-D1

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0556 (transmembrane protein), high confidence from genomic context alone (score 763 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0556 transmembrane protein 763 763 ctx cooccurence:763
Rv2446c integral membrane protein 761 761 ctx cooccurence:761
Rv3212 hyp hypothetical protein 761 761 ctx cooccurence:761
Rv3311 hyp hypothetical protein 760 760 ctx cooccurence:760
Rv1109c hyp hypothetical protein 759 759 ctx cooccurence:759
Rv3438 hyp hypothetical protein 755 755 ctx cooccurence:755
Rv0358 hyp hypothetical protein 752 752 ctx cooccurence:752
Rv1209 hyp hypothetical protein 751 751 ctx cooccurence:743
Rv1083 hyp hypothetical protein 748 748 ctx cooccurence:748
Rv3004 cfp6 low molecular weight protein antigen 6 740 740 ctx cooccurence:740
Rv0419 lpqM lipoprotein peptidase LpqM 735 735 ctx cooccurence:735
Rv3850 hyp hypothetical protein 735 735 ctx cooccurence:735
Rv1166 lpqW monoacyl phosphatidylinositol tetramannoside-binding protein LpqW 732 732 ctx cooccurence:732
Rv2976c ung uracil-DNA glycosylase 728 728 ctx neighborhood:728
Rv2732c transmembrane protein 721 721 ctx cooccurence:721

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DUF3515 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF3515 PF12028.14 (E=1e-54)
  • Foldseek best: 5y39-assembly1_B Crystal structure of Ragulator complex (p18 76-145) (prob 0.38, E=5e-01, TM=0.58)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217496.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF3515 (PF12028.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2ECK0
  • Curated reference: UniProt P95115 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 95.6, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 106 functional partner(s); context anchor Rv0556
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003165|Rv2980|
MTGESDGPPRAVLIAAAALAAAVIGVILVVAANRQPPERPVVIPAVPAPQATGPGCKALLAALPQRLGEYRRAPVAEPTTAGATAWRTGPNSTPVILRCGLDRPAEFVVGSAIQVVDRVQWFQVAAQNPDEPGRSTWYTVDRPVYVALTLPSGSGPTAIQELSDVIDHTIPAVPIDPAPAR