Rv2854 Family assigned · medium auto-curated
H37Rv Rv2854 · MTBC0 mtbc0_003033 ·
346 aa · 3184818–3185858 (+) ·
RefSeq NP_217370.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | alpha/beta hydrolase |
| Revised (this work) | Alpha/beta hydrolase. Pfam: Hydrolase_4 (PF12146.16), Abhydrolase_1 (PF00561.27), Abhydrolase_6 (PF12697.14). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O05805
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Serine aminopeptidase S33 domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
I Lipid transport and metabolism
|
|---|---|
| eggNOG description | Serine aminopeptidase, S33 |
| Orthologous group | COG2267 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.41 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Hydrolase_4 | PF12146.16 | 1.7e-16 | 51–194 | Serine aminopeptidase, S33 |
Abhydrolase_1 | PF00561.27 | 1.7e-10 | 53–165 | alpha/beta hydrolase fold |
Abhydrolase_6 | PF12697.14 | 4.4e-13 | 54–315 | Alpha/beta hydrolase family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: mtr (mycothione reductase), high confidence from genomic context alone (score 877 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv3150 nuoF |
NADH-quinone oxidoreductase subunit F | 902 | 897 | coexpression:454 experimental:817 |
Rv3151 nuoG |
NADH-quinone oxidoreductase subunit G | 897 | 888 | coexpression:413 experimental:817 |
Rv3148 nuoD |
NADH-quinone oxidoreductase subunit D | 885 | 880 | experimental:817 |
Rv2855 mtr |
mycothione reductase | 883 | 877 ctx | neighborhood:869 |
Rv3149 nuoE |
NADH-quinone oxidoreductase subunit E | 876 | 876 | coexpression:443 experimental:787 |
Rv3153 nuoI |
NADH-quinone oxidoreductase subunit I | 855 | 855 | experimental:817 |
Rv3146 nuoB |
NADH-quinone oxidoreductase subunit B | 829 | 829 | experimental:787 |
Rv3147 nuoC |
NADH-quinone oxidoreductase subunit C | 837 | 828 | experimental:817 |
Rv3152 nuoH |
NADH-quinone oxidoreductase subunit H | 803 | 803 | experimental:803 |
Rv0310c hyp |
hypothetical protein | 803 | 800 | experimental:787 |
Rv3145 nuoA |
NADH-quinone oxidoreductase subunit A | 788 | 788 | experimental:787 |
Rv3157 nuoM |
NADH-quinone oxidoreductase subunit M | 787 | 788 | experimental:787 |
Rv3158 nuoN |
NADH-quinone oxidoreductase subunit N | 730 | 730 | experimental:729 |
Rv2852c mqo |
malate:quinone oxidoreductase | 726 | 727 ctx | neighborhood:725 |
Rv2851c |
GCN5-like N-acetyltransferase | 689 | 690 ctx | neighborhood:688 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: alpha/beta hydrolase
- Pfam (hmmscan --cut_ga): Hydrolase_4 PF12146.16 (E=2e-16), Abhydrolase_1 PF00561.27 (E=2e-10), Abhydrolase_6 PF12697.14 (E=4e-13)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217370.1)
- Domains: Pfam-A via hmmscan --cut_ga — Hydrolase_4 (PF12146.16), Abhydrolase_1 (PF00561.27), Abhydrolase_6 (PF12697.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2267 - Curated reference: UniProt O05805 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
52 functional partner(s); context anchor
mtr - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_003033|Rv2854| MTGWVPDVLPGYWQCTIPLGPDPDDEGDIVATLVGRGPQTGKARGDTTGAHHTVLAVHGYTDYFFHTELADHFANRGFAFYALDLRKCGRSRAPGQTPHFITDLARYDTELEHSLSIINEQNRSAKVLVYGHSAGGLIVSLWLDRLRQRGEITRAGVTGLVLNSPFLDLQGPAILRLPLTSAFFAAMARMRPKWVARPPKEGGYGCTLHRDYDGEFDYNLQWKPVGGFPVTFGWIHASRRGHARLHRGIDVGVPNLILCSDHTVREKADPATLHRGDAVLDVTHITRWAGCIGNRSTVIAVADAKHDVFLSLPQPRQMAYRRLDLWLDDYLGTHNDTDASASSGKG