Rv2854 Family assigned · medium auto-curated

H37Rv Rv2854 · MTBC0 mtbc0_003033 · 346 aa · 3184818–3185858 MTBC0 (+) · RefSeq NP_217370.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationalpha/beta hydrolase
Revised (this work)Alpha/beta hydrolase. Pfam: Hydrolase_4 (PF12146.16), Abhydrolase_1 (PF00561.27), Abhydrolase_6 (PF12697.14).
Functional category (TubercuList)conserved hypotheticals

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) never studied

No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.

A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.

CRISPRi vulnerability

Vulnerability index 1.36 (95% CI -0.45 to 4.58). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser) ahead of Mycobrowser

Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (COG category). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb2879 · 99.7% identity
M. marinum MMAR_1880 · 69.1% identity
M. smegmatis MSMEG_2612 · 65.9% identity
M. orygis RJtmp_002942 · 99.7% identity
M. abscessus MAB_3160 · 58.6% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt O05805 TrEMBL · unreviewed · Evidence at protein level
UniProt nameSerine aminopeptidase S33 domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category I Lipid transport and metabolism
eggNOG descriptionSerine aminopeptidase, S33
Orthologous groupCOG2267

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.41 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 2 consensus substitution(s)
low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 52/53 (98%) · mean identity 70.8% · 4/4 closest MTBAP relatives
conserved across the genus (present in 52/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 9/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 45.9%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 18 in the ORF — 0 in the essential state, 0 growth-defect, 18 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 53.4444444444. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Enzyme activity (activity-based protein profiling) active serine hydrolase confirms atlas call high-confidence target

Directly labelled by a fluorophosphonate activity-based probe in live M. tuberculosis: biochemical proof that this protein is a catalytically active serine hydrolase, not merely a predicted fold. This experimentally corroborates the atlas assignment (Alpha/beta hydrolase. Pfam: Hydrolase_4 (PF12146.16), Abhydrolase_1 (PF00561.27)), which was derived independently from structure and orthology.

Source annotationRv2854 Uncharacterized protein (conserved hypotheticals)
Probe enrichment20.0× over no-probe control (20 = capped maximum)
Covalent-inhibitor competition20.0× (probe labelling blocked by a serine-hydrolase inhibitor)
Active / prioritized atpH 5.0 (growth condition)

experimental (activity-based) confirmation of the atlas serine-hydrolase family assignment; proves the enzyme is catalytically active in live M. tuberculosis. It never changes the verdict here. Source: Li M, Patel HV, ..., Canaan S, Aldridge BB et al., Cell Chem Biol 2021 (PMC8964833; doi:10.1016/j.chembiol.2021.09.002); competitive activity-based protein profiling of FP-reactive serine hydrolases.

Proteomics (mass spectrometry) detected

MS detectiondetected in 10 of 16 independent MS datasets
Integrated abundance15.1 ppm · rank 2487/3519 (29.4th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length346 aa
Molecular weight38.2 kDa
Theoretical pI7.3
GRAVY-0.29 (hydrophilic)
Aliphatic index82.6
Aromaticity0.092
Instability index35.5 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Hydrolase_4PF12146.16 1.7e-1651–194 Serine aminopeptidase, S33
Abhydrolase_1PF00561.27 1.7e-1053–165 alpha/beta hydrolase fold
Abhydrolase_6PF12697.14 4.4e-1354–315 Alpha/beta hydrolase family

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 92.0

PDB hitprobTM-scoreE-valueDescription
7p0y-assembly1_A 1.00 0.79 4.3e-15 sig 7p0y-assembly1_A Crystal Structure of mtbMGL K74A (Substrate Analog Complex)
6eic-assembly1_C 1.00 0.78 4.6e-14 sig 6eic-assembly1_C Crystal structure of Rv0183, a Monoglyceride Lipase from Mycobacterium Tuberculosis
6eic-assembly3_B 1.00 0.75 5.2e-14 sig 6eic-assembly3_B Crystal structure of Rv0183, a Monoglyceride Lipase from Mycobacterium Tuberculosis
3jw8-assembly1_A 1.00 0.75 7.0e-14 sig 3jw8-assembly1_A Crystal structure of human mono-glyceride lipase
7l4u-assembly1_A 1.00 0.74 2.0e-13 sig 7l4u-assembly1_A Crystal structure of human monoacylglycerol lipase in complex with compound 1h

Foldseek search of the AlphaFold DB model (mean pLDDT 92.0, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 3

Upstream (5' on genome)PE_PGRS48 (+ strand, 36 bp gap)
Downstream (3' on genome)mtr (+ strand, 12 bp gap)
Predicted operon PE_PGRS48 · Rv2854 · mtr

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: mtr (mycothione reductase), high confidence from genomic context alone (score 877 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv3150 nuoF exp NADH-quinone oxidoreductase subunit F 902 897 coexpression:454 experimental:817
Rv3151 nuoG exp NADH-quinone oxidoreductase subunit G 897 888 coexpression:413 experimental:817
Rv3148 nuoD exp NADH-quinone oxidoreductase subunit D 885 880 experimental:817
Rv2855 mtr mycothione reductase 883 877 ctx neighborhood:869
Rv3149 nuoE exp NADH-quinone oxidoreductase subunit E 876 876 coexpression:443 experimental:787
Rv3153 nuoI exp NADH-quinone oxidoreductase subunit I 855 855 experimental:817
Rv3146 nuoB exp NADH-quinone oxidoreductase subunit B 829 829 experimental:787
Rv3147 nuoC exp NADH-quinone oxidoreductase subunit C 837 828 experimental:817
Rv3152 nuoH exp NADH-quinone oxidoreductase subunit H 803 803 experimental:803
Rv0310c hyp exp hypothetical protein 803 800 experimental:787
Rv3145 nuoA exp NADH-quinone oxidoreductase subunit A 788 788 experimental:787
Rv3157 nuoM exp NADH-quinone oxidoreductase subunit M 787 788 experimental:787
Rv3158 nuoN exp NADH-quinone oxidoreductase subunit N 730 730 experimental:729
Rv2852c mqo malate:quinone oxidoreductase 726 727 ctx neighborhood:725
Rv2851c GCN5-like N-acetyltransferase 689 690 ctx neighborhood:688

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: alpha/beta hydrolase
  • Pfam (hmmscan --cut_ga): Hydrolase_4 PF12146.16 (E=2e-16), Abhydrolase_1 PF00561.27 (E=2e-10), Abhydrolase_6 PF12697.14 (E=4e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217370.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Hydrolase_4 (PF12146.16), Abhydrolase_1 (PF00561.27), Abhydrolase_6 (PF12697.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2267
  • Curated reference: UniProt O05805 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 92.0)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 52 functional partner(s); context anchor mtr
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003033|Rv2854|
MTGWVPDVLPGYWQCTIPLGPDPDDEGDIVATLVGRGPQTGKARGDTTGAHHTVLAVHGYTDYFFHTELADHFANRGFAFYALDLRKCGRSRAPGQTPHFITDLARYDTELEHSLSIINEQNRSAKVLVYGHSAGGLIVSLWLDRLRQRGEITRAGVTGLVLNSPFLDLQGPAILRLPLTSAFFAAMARMRPKWVARPPKEGGYGCTLHRDYDGEFDYNLQWKPVGGFPVTFGWIHASRRGHARLHRGIDVGVPNLILCSDHTVREKADPATLHRGDAVLDVTHITRWAGCIGNRSTVIAVADAKHDVFLSLPQPRQMAYRRLDLWLDDYLGTHNDTDASASSGKG