Rv2859c Resolved · high auto-curated

H37Rv Rv2859c · MTBC0 mtbc0_003040 · 308 aa · 3191386–3192312 (-) · RefSeq NP_217375.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)glutamine amidotransferase
MTBC0 PGAP re-annotationgamma-glutamyl-gamma-aminobutyrate hydrolase
Revised (this work)Gamma-glutamyl-gamma-aminobutyrate hydrolase. Pfam: Peptidase_C26 (PF07722.20), GATase (PF00117.35).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O33341 SwissProt · reviewed · Evidence at protein level
UniProt namePutative glutamine amidotransferase Rv2859c
EC (curated) EC 2.4.2.-

UniProt still lists this protein as Putative glutamine amidotransferase Rv2859c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionglutamine amidotransferase
Orthologous groupCOG2071
KEGG orthology K07010

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Peptidase_C26PF07722.20 3.2e-7266–279 Peptidase C26
GATasePF00117.35 2.6e-13161–282 Glutamine amidotransferase class-I

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: glnA4 (glutamine synthetase), high confidence from genomic context alone (score 961 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2860c glnA4 glutamine synthetase 963 961 ctx neighborhood:881 cooccurence:459 coexpression:445
Rv2857c 3-oxoacyl-ACP reductase 927 927 ctx neighborhood:882
Rv2858c aldC aldehyde dehydrogenase AldC 928 925 ctx neighborhood:882
Rv2861c mapB methionine aminopeptidase 539 539 ctx neighborhood:535
Rv0255c cobQ1 cobyric acid synthase 444 445 ctx neighborhood:440
Rv1127c ppdK pyruvate, phosphate dikinase PpdK 467 442
Rv1878 glnA3 glutamine synthetase GlnA 475 440 coexpression:421
Rv2220 glnA1 glutamine synthetase 474 440 coexpression:421
Rv2222c glnA2 glutamine synthetase 475 439 coexpression:420
Rv2862c hyp hypothetical protein 421 421 ctx neighborhood:419
Rv2589 gabT 4-aminobutyrate aminotransferase 434 402
Rv2047c hyp hypothetical protein 429 402
Rv3329 aminotransferase 411 389

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: glutamine amidotransferase
  • MTBC0 PGAP product: gamma-glutamyl-gamma-aminobutyrate hydrolase
  • Pfam (hmmscan --cut_ga): Peptidase_C26 PF07722.20 (E=3e-72), GATase PF00117.35 (E=3e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217375.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Peptidase_C26 (PF07722.20), GATase (PF00117.35)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2071
  • Curated reference: UniProt O33341 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s); context anchor glnA4
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003040|Rv2859c|
MDLSASRSDGGDPLRPASPRLRSPVSDGGDPLRPASPRLRSPVSDGGDPLRPASPRLRSPLGASRPVVGLTAYLEQVRTGVWDIPAGYLPADYFEGITMAGGVAVLLPPQPVDPESVGCVLDSLHALVITGGYDLDPAAYGQEPHPATDHPRPGRDAWEFALLRGALQRGMPVLGICRGTQVLNVALGGTLHQHLPDILGHSGHRAGNGVFTRLPVHTASGTRLAELIGESADVPCYHHQAIDQVGEGLVVSAVDVDGVIEALELPGDTFVLAVQWHPEKSLDDLRLFKALVDAASGYAGRQSQAEPR