vapB2 Resolved · high auto-curated

H37Rv Rv0300 · MTBC0 mtbc0_000319 · 73 aa · 367165–367386 (+) · RefSeq NP_214814.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)antitoxin VapB2
MTBC0 PGAP re-annotationtype II toxin-antitoxin system antitoxin VapB2
Revised (this work)Type II toxin-antitoxin system antitoxin VapB2. Pfam: RHH_1 (PF01402.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O07227 SwissProt · reviewed · Evidence at protein level
UniProt nameAntitoxin VapB2
Curated functionAntitoxin component of a type II toxin-antitoxin (TA) system. Upon expression in M.smegmatis neutralizes the effect of cognate toxin VapC2. The C-terminal helix of the antitoxin may obstruct the toxin's RNA-binding groove, blocking access to the active sites. Additionally, the C-terminal arginine of the antitoxin may remove Mg(2+) ions from the toxin active sites.

Functional vocabulary (eggNOG-mapper, orthology transfer)

Orthologous group2EI9R
Gene Ontology (53) GO:0006417, GO:0008150, GO:0009889, GO:0009891, GO:0009892, GO:0009893, GO:0010468, GO:0010556, GO:0010557, GO:0010604, GO:0010605, GO:0010608 +41 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.178 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RHH_1PF01402.28 2.9e-059–37 Ribbon-helix-helix protein, copG family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC2 (ribonuclease VapC2), high confidence from genomic context alone (score 1000 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0301 vapC2 ribonuclease VapC2 999 1000 ctx neighborhood:882 experimental:999 textmining:870
Rv0299 toxin 781 781 ctx neighborhood:667
Rv0298 antitoxin 681 681 ctx neighborhood:667
Rv0302 transcriptional regulator 532 532 ctx neighborhood:520
Rv0303 dehydrogenase/reductase 504 504 ctx neighborhood:504
Rv2010 vapC15 ribonuclease VapC15 814 454 experimental:412 textmining:674
Rv0627 vapC5 ribonuclease VapC5 925 449 experimental:412 textmining:870
Rv0229c vapC51 hyp hypothetical protein 444 445 experimental:412
Rv1561 vapC11 ribonuclease VapC11 438 439 experimental:412
Rv1397c vapC10 ribonuclease VapC10 435 436 experimental:412
Rv0665 vapC8 ribonuclease VapC8 435 435 experimental:412
Rv0656c vapC6 ribonuclease VapC6 434 435 experimental:412
Rv0595c vapC4 ribonuclease VapC4 520 434 experimental:412
Rv2527 vapC17 ribonuclease VapC17 433 434 experimental:412
Rv1114 vapC32 ribonuclease VapC32 433 434 experimental:412

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: antitoxin VapB2
  • MTBC0 PGAP product: type II toxin-antitoxin system antitoxin VapB2
  • Pfam (hmmscan --cut_ga): RHH_1 PF01402.28 (E=3e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214814.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RHH_1 (PF01402.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EI9R
  • Curated reference: UniProt O07227 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 26 functional partner(s); context anchor vapC2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000319|Rv0300|vapB2
MSDVLIRDIPDDVLASLDAIAARLGLSRTEYIRRRLAQDAQTARVTVTAADLRRLRGAVAGLGDPELMRQAWR