Rv0366c Family assigned · medium auto-curated
H37Rv Rv0366c · MTBC0 mtbc0_000386 ·
197 aa · 447584–448177 (-) ·
RefSeq NP_214880.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | zeta toxin family protein |
| Revised (this work) | Zeta toxin family protein. Pfam: Zeta_toxin (PF06414.19), AAA_33 (PF13671.13). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53701
TrEMBL · unreviewed
· Inferred from homology
|
|---|---|
| UniProt name | UDP-N-acetylglucosamine kinase |
| EC (curated) |
EC 2.7.1.176
|
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Zeta toxin |
| Orthologous group | COG4185 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.721 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Zeta_toxin | PF06414.19 | 1.5e-14 | 4–156 | Zeta toxin |
AAA_33 | PF13671.13 | 4.6e-14 | 6–138 | AAA domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0369c (membrane oxidoreductase), medium confidence from genomic context alone (score 537 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0367c hyp |
hypothetical protein | 984 | 847 ctx | neighborhood:843 textmining:902 |
Rv0365c hyp |
hypothetical protein | 968 | 766 ctx | neighborhood:757 textmining:870 |
Rv0368c hyp |
hypothetical protein | 937 | 537 ctx | neighborhood:534 textmining:870 |
Rv0369c |
membrane oxidoreductase | 537 | 537 ctx | neighborhood:534 |
Rv2017 |
transcriptional regulator | 693 | 451 | experimental:434 textmining:465 |
Rv0465c ramB |
HTH-type transcriptional regulator | 476 | 448 | experimental:434 |
Rv0023 |
transcriptional regulator | 476 | 448 | experimental:434 |
Rv2745c clgR |
transcriptional regulator ClgR | 475 | 447 | experimental:434 |
Rv0474 |
HTH-type transcriptional regulator | 475 | 447 | experimental:434 |
Rv3183 higA3 |
transcriptional regulator | 475 | 447 | experimental:434 |
Rv3849 espR |
ESX-1 transcriptional regulator EspR | 473 | 445 | experimental:434 |
Rv2021c higA2 |
transcriptional regulator | 473 | 445 | experimental:434 |
Rv1129c prpR |
transcriptional regulator | 473 | 445 | experimental:434 |
Rv1113 vapB32 |
antitoxin VapB32 | 423 | 423 ctx | cooccurence:423 |
Rv1114 vapC32 |
ribonuclease VapC32 | 403 | 403 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: zeta toxin family protein
- Pfam (hmmscan --cut_ga): Zeta_toxin PF06414.19 (E=1e-14), AAA_33 PF13671.13 (E=5e-14)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214880.1)
- Domains: Pfam-A via hmmscan --cut_ga — Zeta_toxin (PF06414.19), AAA_33 (PF13671.13)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG4185 - Curated reference: UniProt O53701 (TrEMBL, unreviewed; Inferred from homology)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
31 functional partner(s); context anchor
Rv0369c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000386|Rv0366c| MKRLDLVAGPNGAGKSTFVALTLAPLLPGIVFVNADEIAKQRWPDDPTSHAYQAAQVAADTRARLIDLGRPFIAETVFSHPSKLELIRTARTAGYTVVLHVLVIPEGLAVERVRHRVAAGGHDVPETKIRERHRRLAELVAQAITLADGATVYDNSRLAGPRIVAQFSGGGIIGRACWPSWTPPPLMSRWSNRPETA