glbN Resolved · high auto-curated

H37Rv Rv1542c · MTBC0 mtbc0_001649 · 136 aa · 1754235–1754645 (-) · RefSeq NP_216058.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hemoglobin GlbN
MTBC0 PGAP re-annotationgroup 1 truncated hemoglobin GlbN
Revised (this work)Group 1 truncated hemoglobin GlbN. Pfam: Bac_globin (PF01152.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WN25 SwissProt · reviewed · Evidence at protein level
UniProt nameGroup 1 truncated hemoglobin GlbN
Curated functionBinds oxygen cooperatively with very high affinity (P(50) = 0.013 mmHg at 20 degrees Celsius) because of a fast combination (25 microM(-1)sec(-1)) and a slow dissociation (0.2 sec(-1)) rate.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred nameglbN
eggNOG descriptionGroup 1 truncated hemoglobin
Orthologous groupCOG2346
KEGG orthology K06886
Gene Ontology (76) GO:0001505, GO:0003674, GO:0003824, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0006807, GO:0008144, GO:0008150 +64 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Bac_globinPF01152.28 2.3e-3614–127 Bacterial-like globin

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lprI (lipoprotein LprI), medium confidence from genomic context alone (score 661 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1541c lprI lipoprotein LprI 697 661 ctx neighborhood:656
Rv1544 ketoacyl reductase 540 540 ctx neighborhood:540
Rv1543 oxidoreductase 699 493 ctx neighborhood:490 textmining:430
Rv1545 hyp hypothetical protein 455 455 ctx neighborhood:455
Rv2466c hyp hypothetical protein 500 449 coexpression:417
Rv1546 hyp hypothetical protein 435 435 ctx neighborhood:435
Rv1547 dnaE1 DNA polymerase III subunit alpha 433 433 ctx neighborhood:432
Rv0385 monooxygenase 884 373 textmining:824
Rv0267 narU nitrite extrusion protein NarU 533 180 textmining:454
Rv0261c narK3 nitrate/nitrite transporter 666 105 textmining:643
Rv1705c PPE22 PPE family protein PPE22 524 67 textmining:511
Rv1360 oxidoreductase 663 63 textmining:656
Rv3125c PPE49 PPE family protein PPE49 518 55 textmining:511
Rv1548c PPE21 PPE family protein PPE21 654 50 textmining:651
Rv1528c papA4 polyketide synthase associated protein PapA 436 50 textmining:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hemoglobin GlbN
  • MTBC0 PGAP product: group 1 truncated hemoglobin GlbN
  • Pfam (hmmscan --cut_ga): Bac_globin PF01152.28 (E=2e-36)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216058.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Bac_globin (PF01152.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2346
  • Curated reference: UniProt P9WN25 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 20 functional partner(s); context anchor lprI
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001649|Rv1542c|glbN
MGLLSRLRKREPISIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEPYTGAPMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTSGESTTAPV