Rv2307c Family assigned · medium auto-curated
H37Rv Rv2307c · MTBC0 mtbc0_002447 ·
281 aa · 2602600–2603445 (-) ·
RefSeq NP_216823.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | alpha/beta hydrolase |
| Revised (this work) | Alpha/beta hydrolase. Pfam: Abhydrolase_1 (PF00561.27), Hydrolase_4 (PF12146.16). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WLC7
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv2307c |
UniProt still lists this protein as Uncharacterized protein Rv2307c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Serine aminopeptidase, S33 |
| Orthologous group | COG1073 |
| KEGG orthology |
K06889
|
| Gene Ontology (30) |
GO:0005575, GO:0005618, GO:0005623, GO:0008150, GO:0009605, GO:0009607, GO:0030312, GO:0035821, GO:0043207, GO:0044003, GO:0044403, GO:0044419 +18 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.382 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Abhydrolase_1 | PF00561.27 | 5.5e-08 | 79–187 | alpha/beta hydrolase fold |
Hydrolase_4 | PF12146.16 | 5.3e-09 | 80–185 | Serine aminopeptidase, S33 |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0557 mgtA |
GDP-mannose-dependent alpha-mannosyltransferase | 568 | 548 | experimental:443 |
Rv2188c pimB |
alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase | 544 | 522 | experimental:443 |
Rv1847 |
esterase | 515 | 497 | database:485 |
Rv1532c hyp |
hypothetical protein | 513 | 494 | database:485 |
Rv0356c hyp |
hypothetical protein | 512 | 493 | database:485 |
Rv1551 plsB1 |
acyltransferase PlsB | 510 | 491 | |
Rv3671c marP |
serine protease | 484 | 484 | database:468 |
Rv1223 htrA |
serine protease HtrA | 483 | 484 | database:468 |
Rv0125 pepA |
serine protease PepA | 481 | 481 | database:468 |
Rv0983 pepD |
serine protease PepD | 481 | 481 | database:468 |
Rv1043c hyp |
hypothetical protein | 480 | 481 | database:468 |
Rv0499 hyp |
hypothetical protein | 489 | 465 | database:460 |
Rv1618 tesB1 |
acyl-CoA thioesterase II | 485 | 461 | database:460 |
Rv2605c tesB2 |
acyl-CoA thioesterase II | 485 | 460 | database:460 |
Rv2729c |
integral membrane protein | 484 | 460 | experimental:443 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: alpha/beta hydrolase
- Pfam (hmmscan --cut_ga): Abhydrolase_1 PF00561.27 (E=6e-08), Hydrolase_4 PF12146.16 (E=5e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216823.1)
- Domains: Pfam-A via hmmscan --cut_ga — Abhydrolase_1 (PF00561.27), Hydrolase_4 (PF12146.16)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1073 - Curated reference: UniProt P9WLC7 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 43 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002447|Rv2307c| MSLKRCRALPVVAIVALVASGVITFIWSQQRRLIYFPSAGPVPSASSVLPAGRDVVVETQDGMRLGGWYFPHTSGGSGPAVLVCNGNAGDRSMRAELAVALHGLGLSVLLFDYRGYGGNPGRPSEQGLAADARAAQEWLSGQSDVDPARIAYFGESLGAAVAVGLAVQRPPAALVLRSPFTSLAEVGAVHYPWLPLRRLLLDHYPSIERIASVHAPVLVIAGGSDDIVPATLSERLVAAAAEPKRYVVVPGVGHNDPELLDGRVMLDAIRRFLTETAVLGQ