Rv2307c Family assigned · medium auto-curated

H37Rv Rv2307c · MTBC0 mtbc0_002447 · 281 aa · 2602600–2603445 (-) · RefSeq NP_216823.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationalpha/beta hydrolase
Revised (this work)Alpha/beta hydrolase. Pfam: Abhydrolase_1 (PF00561.27), Hydrolase_4 (PF12146.16).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WLC7 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv2307c

UniProt still lists this protein as Uncharacterized protein Rv2307c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionSerine aminopeptidase, S33
Orthologous groupCOG1073
KEGG orthology K06889
Gene Ontology (30) GO:0005575, GO:0005618, GO:0005623, GO:0008150, GO:0009605, GO:0009607, GO:0030312, GO:0035821, GO:0043207, GO:0044003, GO:0044403, GO:0044419 +18 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.382 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Abhydrolase_1PF00561.27 5.5e-0879–187 alpha/beta hydrolase fold
Hydrolase_4PF12146.16 5.3e-0980–185 Serine aminopeptidase, S33

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv0557 mgtA GDP-mannose-dependent alpha-mannosyltransferase 568 548 experimental:443
Rv2188c pimB alpha-(1-6)-phosphatidylinositol monomannoside mannosyltransferase 544 522 experimental:443
Rv1847 esterase 515 497 database:485
Rv1532c hyp hypothetical protein 513 494 database:485
Rv0356c hyp hypothetical protein 512 493 database:485
Rv1551 plsB1 acyltransferase PlsB 510 491
Rv3671c marP serine protease 484 484 database:468
Rv1223 htrA serine protease HtrA 483 484 database:468
Rv0125 pepA serine protease PepA 481 481 database:468
Rv0983 pepD serine protease PepD 481 481 database:468
Rv1043c hyp hypothetical protein 480 481 database:468
Rv0499 hyp hypothetical protein 489 465 database:460
Rv1618 tesB1 acyl-CoA thioesterase II 485 461 database:460
Rv2605c tesB2 acyl-CoA thioesterase II 485 460 database:460
Rv2729c integral membrane protein 484 460 experimental:443

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: alpha/beta hydrolase
  • Pfam (hmmscan --cut_ga): Abhydrolase_1 PF00561.27 (E=6e-08), Hydrolase_4 PF12146.16 (E=5e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216823.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Abhydrolase_1 (PF00561.27), Hydrolase_4 (PF12146.16)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1073
  • Curated reference: UniProt P9WLC7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 43 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002447|Rv2307c|
MSLKRCRALPVVAIVALVASGVITFIWSQQRRLIYFPSAGPVPSASSVLPAGRDVVVETQDGMRLGGWYFPHTSGGSGPAVLVCNGNAGDRSMRAELAVALHGLGLSVLLFDYRGYGGNPGRPSEQGLAADARAAQEWLSGQSDVDPARIAYFGESLGAAVAVGLAVQRPPAALVLRSPFTSLAEVGAVHYPWLPLRRLLLDHYPSIERIASVHAPVLVIAGGSDDIVPATLSERLVAAAAEPKRYVVVPGVGHNDPELLDGRVMLDAIRRFLTETAVLGQ