Rv2305 Family assigned · medium
H37Rv Rv2305 · MTBC0 mtbc0_002445 ·
429 aa ·
2600558–2601847 MTBC0
(+) ·
RefSeq NP_216821.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Condensation/epimerization-domain-like fold of the non-ribosomal peptide synthetase (NRPS) superfamily. RefSeq leaves it 'hypothetical protein'. The AlphaFold model superposes strongly on an NRPS epimerization domain (PDB 6ta8; Foldseek prob 1.0, E 3e-21, TM 0.67), and eggNOG places it near D-alanyl carrier / D-Ala-D-Ala chemistry (COG Q, secondary metabolism). Fold/family assignment; the catalysed step and substrate are undemonstrated. |
| Functional category (TubercuList) | conserved hypotheticals |
In the literature (TB corpus sweep) never studied
No publication in PubMed mentions this gene in its title or abstract — not under its H37Rv locus tag, nor under any of its ortholog identifiers (M. bovis, M. marinum, M. smegmatis, M. leprae, M. abscessus). The atlas annotation rests on sequence/structure evidence, not on a primary study of this gene.
A verified absence of literature is itself information: it flags an annotation with no primary study behind it. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep: H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73/phase75, 2026-07-13.
CRISPRi vulnerability
Vulnerability index 1.25 (95% CI -0.13 to 3.58). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser) ahead of Mycobrowser
Mycobrowser classes this locus among conserved hypotheticals; the atlas now assigns a functional handle (COG category). Mycobrowser is no longer maintained, so its EC numbers predate recent nomenclature revisions (e.g. the 2018 EC 7 "translocase" class) — most EC differences are re-numberings of the same enzyme, not conflicts.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2327
· 99.8% identity |
|---|---|
| M. orygis |
RJtmp_002378
· 99.8% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WLD1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Uncharacterized protein Rv2305 |
UniProt still lists this protein as Uncharacterized protein Rv2305; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| eggNOG description | D-alanine [D-alanyl carrier protein] ligase activity |
| Orthologous group | COG1020 |
| Gene Ontology (6) |
GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.442 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 5 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Mycobacterium
| M. canettii dN/dS (deep-divergence selection) |
0.185 (low power)
· 3 consensus substitution(s) low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 4/53 (8%) · mean identity 59.1%
· 3/4 closest MTBAP relatives present in a subset of the genus (4/53 NTM; in 3 of the 4 closest MTBAP relatives) — partial/intermediate conservation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis)
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 10 in the ORF — 0 in the essential state, 0 growth-defect, 10 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 99. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 12 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 60.0 ppm · rank 1635/3519 (53.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 429 aa |
|---|---|
| Molecular weight | 46.1 kDa |
| Theoretical pI | 5.67 |
| GRAVY | 0.118 (hydrophobic) |
| Aliphatic index | 101.2 |
| Aromaticity | 0.063 |
| Instability index | 41.2 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 86.3
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
6ta8-assembly2_B |
1.00 | 0.67 | 3.4e-21 sig | 6ta8-assembly2_B Crystal structure of the epimerization domain from the third module of tyrocidine synthetase B, TycB3(E) |
8rz6-assembly1_B |
1.00 | 0.70 | 2.1e-19 sig | 8rz6-assembly1_B SeMet derivative structure of the condensation domain TomBC from the Tomaymycin non-ribosomal peptide synthetase |
8qnf-assembly1_A |
1.00 | 0.68 | 3.0e-19 sig | 8qnf-assembly1_A Crystal structure of the Condensation domain TomBC from the Tomaymycin non-ribosomal peptide synthetase |
7kvw-assembly1_A |
1.00 | 0.67 | 8.5e-20 sig | 7kvw-assembly1_A Non-ribosomal didomain (holo-PCP-C) acceptor bound state |
8fx6-assembly2_B |
1.00 | 0.69 | 7.1e-19 sig | 8fx6-assembly2_B Non-ribosomal PCP-C didomain (amide stabilised leucine) acceptor bound state |
Foldseek search of the AlphaFold DB model (mean pLDDT 86.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | Rv2304c (- strand, 583 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2307c (- strand, 752 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
Rv1990c (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: Rv2306A (Rv2306A, len: 197 aa. Possible conserved membrane protein, similar to several hypothetical membrane proteins from Mycobacterium tuberculosis), high confidence from genomic context alone (score 774 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2082 hyp |
hypothetical protein | 818 | 818 ctx | cooccurence:718 |
Rv2306A |
Rv2306A, len: 197 aa. Possible conserved membrane protein, similar to several hypothetical membrane proteins from Mycobacterium tuberculosis | 774 | 774 ctx | neighborhood:770 |
Rv2490c PE_PGRS43 |
PE-PGRS family protein PE_PGRS43 | 772 | 772 ctx | cooccurence:772 |
Rv0341 iniB |
isoniazid inducible protein IniB | 768 | 769 ctx | cooccurence:768 |
Rv2098c PE_PGRS36 |
PE-PGRS family protein PE_PGRS36; Rv2098c, (MTCY49.38c), len: 434 aa. PE_PGRS36,Member of the Mycobacterium tuberculosis PE family, PGRS sub | 767 | 767 ctx | cooccurence:766 |
Rv2306B |
Rv2306B, len: 144 aa. Possible conserved membrane protein, similar to C-terminal part of several hypothetical membrane proteins from Mycobac | 766 | 766 ctx | neighborhood:763 |
Rv2487c PE_PGRS42 |
PE-PGRS family protein PE_PGRS42 | 765 | 765 ctx | cooccurence:765 |
Rv0355c PPE8 |
PPE family protein PPE8 | 759 | 759 ctx | cooccurence:758 |
Rv3347c PPE55 |
PPE family protein PPE55 | 758 | 759 ctx | cooccurence:757 |
Rv3350c PPE56 |
PPE family protein PPE56 | 758 | 758 ctx | cooccurence:756 |
Rv1452c PE_PGRS28 |
PE-PGRS family protein PE_PGRS28 | 758 | 758 ctx | cooccurence:758 |
Rv2209 |
integral membrane protein | 757 | 757 ctx | cooccurence:756 |
Rv1004c |
membrane protein | 756 | 757 ctx | cooccurence:755 |
Rv0304c PPE5 |
PPE family protein PPE5 | 751 | 752 ctx | cooccurence:751 |
Rv3800c pks13 |
polyketide synthase | 807 | 745 | coexpression:708 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Foldseek -> NRPS condensation/epimerization domain (6ta8), prob 1.0, E 3e-21, TM 0.67
- eggNOG COG Q (secondary metabolite); D-alanyl-carrier-related OG
- Structural homology: AlphaFold DB model + Foldseek vs PDB (project 'Still unknown gene function', phase5-7, 2026-06-10). A fold-level family assignment, not a demonstrated activity.
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216821.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1020 - Curated reference: UniProt P9WLD1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 86.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
127 functional partner(s); context anchor
Rv2306A - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_002445|Rv2305| MTQTLRLTALDEMFITDDIDIVPSVQIEARVSGRFDLDRLAAALRAAVAKHALARARLGRASLTARTLYWEVPDRADHLAVEITDEPVGEVRSRFYARAPELHRSPVFAVAVVRETVGDRLLLNFHHAAFDGMGGLRLLLSLARAYAGEPDEVGGPPIEEARNLKGVAGSRDLFDVLIRARGLAKPAIDRKRTTRVAPDGGSPDGPRFVFAPLTIESDEMATAVARRPEGATVNDLAMAALALTILQWNRTHDVPAADSVSVNMPVNFRPTAWSTEVISNFASYLAIVLRVDEVTDLEKATAIVAGITGPLKQSGAAGWVVDLLEGGKVLPAMLKRQLQLLLPLVEDRFVESVCLSNLGRVDVPAFGGEAGDTTEVWFSPTAAMSVMPIGVGLVGFGGTLRAMFRGDGRTIGGEALGRFAALYRDTLLT
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv2305? Email the maintainer — the message is pre-filled with this gene's details.