Rv1532c Family assigned · medium auto-curated
H37Rv Rv1532c · MTBC0 mtbc0_001639 ·
144 aa · 1742925–1743359 (-) ·
RefSeq NP_216048.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | PaaI family thioesterase |
| Revised (this work) | PaaI family thioesterase. Pfam: DUF4442 (PF14539.13), 4HBT (PF03061.29). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O06178
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Thioesterase domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| eggNOG description | Domain of unknown function (DUF4442) |
| Orthologous group | COG2050 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.324 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 2 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.81% of strains (1178) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF4442 | PF14539.13 | 4.2e-09 | 20–141 | Domain of unknown function (DUF4442) |
4HBT | PF03061.29 | 2.8e-13 | 58–134 | Thioesterase superfamily |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv1534 (transcriptional regulator), high confidence from genomic context alone (score 826 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1534 |
transcriptional regulator | 825 | 826 ctx | neighborhood:787 |
Rv2383c mbtB |
phenyloxazoline synthase | 707 | 665 | coexpression:432 experimental:402 |
Rv1533 |
monooxygenase | 614 | 615 ctx | neighborhood:609 |
Rv3824c papA1 |
acyltransferase | 545 | 539 ctx | cooccurence:408 |
Rv1182 papA3 |
acyltransferase papA3 | 535 | 528 | |
Rv3820c papA2 |
trehalose-2-sulfate acyltransferase | 529 | 522 | |
Rv2524c fas |
fatty acid synthase | 655 | 513 | coexpression:412 |
Rv2307c hyp |
hypothetical protein | 513 | 494 | database:485 |
Rv2627c hyp |
hypothetical protein | 508 | 489 | database:485 |
Rv0210 hyp |
hypothetical protein | 464 | 465 ctx | cooccurence:463 |
Rv1293 lysA |
diaminopimelate decarboxylase | 450 | 422 | coexpression:403 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: PaaI family thioesterase
- Pfam (hmmscan --cut_ga): DUF4442 PF14539.13 (E=4e-09), 4HBT PF03061.29 (E=3e-13)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216048.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF4442 (PF14539.13), 4HBT (PF03061.29)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2050 - Curated reference: UniProt O06178 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
11 functional partner(s); context anchor
Rv1534 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001639|Rv1532c| MSDPLTAQEQHKRRQAVRELMPRTPFIGGLGIVFERYEPDDVVIRLPFRTDLTNDGTYFHGGVIASVMDTAGAAAAWSNHDFDRGTRAATVAMSIQYTGAAKRCDLLCHARTARRRKELTFTEITATDPDGNIVAHAVQTYRIV