Rv1532c Family assigned · medium auto-curated

H37Rv Rv1532c · MTBC0 mtbc0_001639 · 144 aa · 1742925–1743359 (-) · RefSeq NP_216048.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationPaaI family thioesterase
Revised (this work)PaaI family thioesterase. Pfam: DUF4442 (PF14539.13), 4HBT (PF03061.29).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06178 TrEMBL · unreviewed · Evidence at protein level
UniProt nameThioesterase domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category Q Secondary metabolites biosynthesis, transport and catabolism
eggNOG descriptionDomain of unknown function (DUF4442)
Orthologous groupCOG2050

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.324 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.81% of strains (1178) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF4442PF14539.13 4.2e-0920–141 Domain of unknown function (DUF4442)
4HBTPF03061.29 2.8e-1358–134 Thioesterase superfamily

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1534 (transcriptional regulator), high confidence from genomic context alone (score 826 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1534 transcriptional regulator 825 826 ctx neighborhood:787
Rv2383c mbtB phenyloxazoline synthase 707 665 coexpression:432 experimental:402
Rv1533 monooxygenase 614 615 ctx neighborhood:609
Rv3824c papA1 acyltransferase 545 539 ctx cooccurence:408
Rv1182 papA3 acyltransferase papA3 535 528
Rv3820c papA2 trehalose-2-sulfate acyltransferase 529 522
Rv2524c fas fatty acid synthase 655 513 coexpression:412
Rv2307c hyp hypothetical protein 513 494 database:485
Rv2627c hyp hypothetical protein 508 489 database:485
Rv0210 hyp hypothetical protein 464 465 ctx cooccurence:463
Rv1293 lysA diaminopimelate decarboxylase 450 422 coexpression:403

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: PaaI family thioesterase
  • Pfam (hmmscan --cut_ga): DUF4442 PF14539.13 (E=4e-09), 4HBT PF03061.29 (E=3e-13)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216048.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF4442 (PF14539.13), 4HBT (PF03061.29)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2050
  • Curated reference: UniProt O06178 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 11 functional partner(s); context anchor Rv1534
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001639|Rv1532c|
MSDPLTAQEQHKRRQAVRELMPRTPFIGGLGIVFERYEPDDVVIRLPFRTDLTNDGTYFHGGVIASVMDTAGAAAAWSNHDFDRGTRAATVAMSIQYTGAAKRCDLLCHARTARRRKELTFTEITATDPDGNIVAHAVQTYRIV