Rv2313c Family assigned · low auto-curated

H37Rv Rv2313c · MTBC0 mtbc0_002461 · 284 aa · 2609801–2610655 (-) · RefSeq NP_216829.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationcarboxymuconolactone decarboxylase family protein
Revised (this work)Carboxymuconolactone decarboxylase family protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WLB7 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv2313c

UniProt still lists this protein as Uncharacterized protein Rv2313c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionAntioxidant protein with alkyl hydroperoxidase activity. Required for the reduction of the AhpC active site cysteine residues and for the regeneration of the AhpC enzyme activity
Orthologous groupCOG2128

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.716 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: uspB (sugar ABC transporter permease UspB), high confidence from genomic context alone (score 788 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv2315c hyp hypothetical protein 879 880 ctx neighborhood:879
Rv2314c hyp hypothetical protein 879 880 ctx neighborhood:879
Rv2317 uspB sugar ABC transporter permease UspB 787 788 ctx neighborhood:788
Rv2316 uspA sugar ABC transporter permease UspA 779 779 ctx neighborhood:779
Rv2318 uspC sugar ABC transporter substrate-binding lipoprotein UspC 719 720 ctx neighborhood:719
Rv1286 cysC adenylyl-sulfate kinase 474 474 coexpression:474
Rv0433 carboxylate-amine ligase 405 406 coexpression:406
Rv1859 modC molybdenum ABC transporter ATP-binding protein ModC 405 406 coexpression:406
Rv2399c cysT sulfate ABC transporter permease CysT 403 403 coexpression:403
Rv3736 AraC/XylS family transcriptional regulator 494 67 textmining:480
Rv1519 hyp hypothetical protein 870 41 textmining:870
Rv3651 hyp hypothetical protein 870 41 textmining:870
Rv3737 transmembrane protein 652 41 textmining:652
Rv3517 hyp hypothetical protein 540 41 textmining:540
Rv3022A PE29 PE family protein PE29 446 41 textmining:446

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: carboxymuconolactone decarboxylase family protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216829.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2128
  • Curated reference: UniProt P9WLB7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 15 functional partner(s); context anchor uspB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002461|Rv2313c|
MPAPVSVRDDLCRLVALSPGDGRIAGLVRQVCARALSLPSLPCEVAVNEPESPAEAVVAEFAEQFSVDVSAITGEQRSLLWTHLGEDAFGAVVAMYIADFVPRVRAGLEALGVGKEYLGWVTGPISWDHNTDLSAAVFNGFLPAVARMRALDPVTSELVRLRGAAQHNCRVCKSLREVSALDAGGSETLYGEIERFDTSVLLDVRAKAALRYADALIWTPAHLAVDVAVEVRSRFSDDEAVELTFDIMRNASNKVAVSLGADAPRVQQGTERYRIGLDGQTVFG