thyA Resolved · high auto-curated
H37Rv Rv2764c · MTBC0 - ·
263 aa ·
3073680–3074471 H37Rv
(-) ·
RefSeq NP_217280.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | thymidylate synthase ThyA |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Thymidylate synthase ThyA. Pfam: Thymidylat_synt (PF00303.25). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) 32 publications
32 TB publications mention this gene. 32 publication(s) discuss this gene (31 in a M. tuberculosis context, 2 in other mycobacteria — M. abscessus (2)).
| Publication | Date |
|---|---|
| Competition between H4PteGlu and H2PtePAS Confers para-Aminosalicylic Acid Resistance in Mycobacterium tuberculosis. doi:10.3390/antibiotics13010013 | 2023 |
| Whole genome sequencing reveals candidate genes involving in PAS resistance in M. Tuberculosis isolated from patients in Thailand. doi:10.1007/s11274-023-03834-7 | 2023 |
| Pharmacological validation of dihydrofolate reductase as a drug target in Mycobacterium abscessus. doi:10.1128/aac.00717-23 | 2024 |
| Comparative genome analysis reveals high-level drug resistance markers in a clinical isolate of Mycobacterium fortuitum subsp. fortuitum MF GZ001. doi:10.3389/fcimb.2022.1056007 | 2022 |
| Determination of critical concentration for drug susceptibility testing of Mycobacterium tuberculosis against para-aminosalicylic acid with clinical isolates with thyA, folC and dfrA mutations. doi:10.1186/s12941-022-00537-z | 2022 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
CRISPRi vulnerability
Vulnerability index -2.62 (95% CI -2.95 to -2.28). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in deoxyribonucleotide biosynthesis. Provides the sole de novo source of dTMP for DANA biosynthesis [catalytic activity: 5,10-methylenetetrahydrofolate + dUMP = dihydrofolate + dTMP]. |
|---|---|
| Mycobrowser EC |
2.1.1.45
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2786c
· 99.6% identity |
|---|---|
| M. leprae |
ML1519c
· 85.5% identity |
| M. marinum |
MMAR_1956
· 89.7% identity |
| M. smegmatis |
MSMEG_2670
· 88.2% identity |
| M. orygis |
RJtmp_002851
· 100.0% identity |
| M. abscessus |
MAB_3091c
· 83.2% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WFR9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Thymidylate synthase ThyA |
| EC (curated) |
EC 2.1.1.45
|
| Curated function | Catalyzes the reductive methylation of 2'-deoxyuridine-5'-monophosphate (dUMP) to 2'-deoxythymidine-5'-monophosphate (dTMP) while utilizing 5,10-methylenetetrahydrofolate (mTHF) as the methyl donor and reductant in the reaction, yielding dihydrofolate (DHF) as a by-product. This enzymatic reaction provides an intracellular de novo source of dTMP, an essential precursor for DNA biosynthesis. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
F Nucleotide transport and metabolism
|
|---|---|
| Preferred name | thyA |
| eggNOG description | Catalyzes the reductive methylation of 2'-deoxyuridine- 5'-monophosphate (dUMP) to 2'-deoxythymidine-5'-monophosphate (dTMP) while utilizing 5,10-methylenetetrahydrofolate (mTHF) as the methyl donor and reductant in the reaction, yielding dihydrofolate (DHF) as a by-product. This enzymatic reaction provides an intracellular de novo source of dTMP, an essential precursor for DNA biosynthesis |
| Orthologous group | COG0207 |
| EC number |
EC 2.1.1.45
|
| KEGG orthology |
K00560
|
| KEGG pathways |
map00240, map00670, map01100, map01523
|
| KEGG modules |
M00053
|
| Gene Ontology (90) |
GO:0003674, GO:0003824, GO:0004799, GO:0006139, GO:0006220, GO:0006221, GO:0006231, GO:0006244, GO:0006725, GO:0006753, GO:0006793, GO:0006796 +78 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.934 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 6 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.0 (low power)
· 3 consensus substitution(s) low power (3 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 89.5%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 72.6% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) GD — not strictly essential
| DeJesus 2017 call | GD · growth-defect |
|---|---|
| What the call means | growth-defect: insertions tolerated but fitness reduced; NOT essential |
| TA sites (Himar1) | 22 in the ORF — 0 in the essential state, 22 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.409, mean read count 1. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | `essential: true` here is the broad union (ES+ESD+GD) kept for backward compatibility; this gene is NOT strictly essential. Read n_sites_* before writing anything about essentiality. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Chemical-genetic target & druggability (PROSPECT) hypomorph tool strain
This gene is part of the PROSPECT collection of TetON transcriptional-knockdown (hypomorph) strains of essential M. tuberculosis genes, built as a sensitised background for chemical-genetic mechanism-of-action deconvolution. Being in the panel means the gene is an essential / vulnerable target for which a validated knockdown tool strain exists.
| Hypomorph strain | thyA-Flag-DAS-tetON-10 (TetON promoter 10) |
|---|---|
| Baseline knockdown fitness | 3.528 median doublings (across 6 screen pool(s)) — fewer doublings = stronger growth defect on knockdown |
| Used in target deconvolution | yes (informs phenotypic-cluster / MOA assignment) |
Panel membership reflects essentiality/vulnerability and the availability of a genetic tool, not a specific molecular function; it never changes the verdict here. Source: Bond AN et al., Nat Commun 2025;16:9673 (doi:10.1038/s41467-025-64662-x); PROSPECT chemical-genetic platform.
Proteomics (mass spectrometry) detected
| MS detection | detected in 13 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 48.3 ppm · rank 1775/3519 (49.6th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 263 aa |
|---|---|
| Molecular weight | 29.9 kDa |
| Theoretical pI | 5.44 |
| GRAVY | -0.186 (hydrophilic) |
| Aliphatic index | 87.5 |
| Aromaticity | 0.122 |
| Instability index | 41.9 (unstable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Thymidylat_synt | PF00303.25 | 2.1e-123 | 3–263 | Thymidylate synthase |
Experimental structures (Protein Data Bank) 5 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
4fqs |
X-ray diffraction | 1.8 Å | 99% |
4foa |
X-ray diffraction | 2.253 Å | 99% |
4fox |
X-ray diffraction | 2.3 Å | 99% |
4fog |
X-ray diffraction | 2.4 Å | 99% |
3qj7 |
X-ray diffraction | 2.504 Å | 99% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (5 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 97.9
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
4fqs-assembly1_A |
1.00 | 1.00 | 7.8e-58 sig | 4fqs-assembly1_A Crystal Structure of Mycobacterium tuberculosis ThyA in complex with UMP and Pemetrexed |
4foa-assembly1_B |
1.00 | 0.99 | 5.5e-55 sig | 4foa-assembly1_B Crystal Structure of the Mtb ThyA in Complex with 5-fluoro-dUMP |
3qj7-assembly2_B |
1.00 | 0.99 | 6.6e-55 sig | 3qj7-assembly2_B Crystal Structure of the Mycobacterium tuberculosis Thymidylate synthase (ThyA) bound to dUMP |
4fog-assembly2_B |
1.00 | 0.99 | 1.0e-53 sig | 4fog-assembly2_B Crystal Structure of Mtb ThyA in Complex with 5-Fluoro-dUMP and 5-methyltetrahydrofolic acid |
2fto-assembly1_X-2 |
1.00 | 0.99 | 1.7e-48 sig | 2fto-assembly1_X-2 Y94F mutant of thymidylate synthase bound to thymidine-5'-phosphate and 10-propargyl-5,8-dideazafolid acid |
Foldseek search of the AlphaFold DB model (mean pLDDT 97.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | dfrA (- strand, 70 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2765 (+ strand, 164 bp gap) |
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: dfrA (dihydrofolate reductase), high confidence from genomic context alone (score 998 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2763c dfrA exp |
dihydrofolate reductase | 999 | 998 ctx | neighborhood:793 cooccurence:774 coexpression:703 database:900 textmining:930 |
Rv2754c thyX exp |
thymidylate synthase ThyX | 997 | 953 ctx | neighborhood:551 database:900 textmining:953 |
Rv2697c dut exp |
deoxyuridine 5'-triphosphate nucleotidohydrolase | 986 | 951 | coexpression:445 database:900 textmining:739 |
Rv3356c folD exp |
bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase | 965 | 924 | database:900 textmining:565 |
Rv3247c tmk exp |
thymidylate kinase | 940 | 918 | database:900 |
Rv1093 glyA1 exp |
serine hydroxymethyltransferase | 942 | 909 | database:900 |
Rv0070c glyA2 exp |
serine hydroxymethyltransferase | 942 | 908 | database:900 |
Rv2211c gcvT exp |
aminomethyltransferase | 928 | 905 | database:900 |
Rv3214 gpm2 |
phosphoglycerate mutase | 895 | 895 ctx | fusion:890 |
Rv2447c folC exp |
folylpolyglutamate synthase FolC | 985 | 801 | database:800 textmining:929 |
Rv2762c hyp |
hypothetical protein | 874 | 733 ctx | neighborhood:730 textmining:548 |
Rv2902c rnhB |
ribonuclease HII | 755 | 708 | coexpression:652 |
Rv1407 fmu |
16S rRNA m5C967 methyltransferase | 720 | 708 | coexpression:667 |
Rv3051c nrdE |
ribonucleoside-diphosphate reductase subunit alpha | 699 | 671 | coexpression:660 |
Rv0002 dnaN |
DNA polymerase III subunit beta | 713 | 658 | coexpression:602 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): thymidylate synthase ThyA
- Pfam (hmmscan --cut_ga): Thymidylat_synt PF00303.25 (E=2e-123)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217280.1)
- Domains: Pfam-A via hmmscan --cut_ga — Thymidylat_synt (PF00303.25)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0207 - Curated reference: UniProt P9WFR9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 97.9)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
85 functional partner(s); context anchor
dfrA - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2764c|thyA MTPYEDLLRFVLETGTPKSDRTGTGTRSLFGQQMRYDLSAGFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWASDTGELGPIYGVQWRSWPAPSGEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADRDSIFEYTYEDIVVKNYDPHPAIKAPVAV
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for thyA? Email the maintainer — the message is pre-filled with this gene's details.