thyA Resolved · high auto-curated

H37Rv Rv2764c · MTBC0 - · 263 aa · 3073680–3074471 (-) · RefSeq NP_217280.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)thymidylate synthase ThyA
MTBC0 PGAP re-annotation
Revised (this work)Thymidylate synthase ThyA. Pfam: Thymidylat_synt (PF00303.25).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WFR9 SwissProt · reviewed · Evidence at protein level
UniProt nameThymidylate synthase ThyA
EC (curated) EC 2.1.1.45
Curated functionCatalyzes the reductive methylation of 2'-deoxyuridine-5'-monophosphate (dUMP) to 2'-deoxythymidine-5'-monophosphate (dTMP) while utilizing 5,10-methylenetetrahydrofolate (mTHF) as the methyl donor and reductant in the reaction, yielding dihydrofolate (DHF) as a by-product. This enzymatic reaction provides an intracellular de novo source of dTMP, an essential precursor for DNA biosynthesis.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category F Nucleotide transport and metabolism
Preferred namethyA
eggNOG descriptionCatalyzes the reductive methylation of 2'-deoxyuridine- 5'-monophosphate (dUMP) to 2'-deoxythymidine-5'-monophosphate (dTMP) while utilizing 5,10-methylenetetrahydrofolate (mTHF) as the methyl donor and reductant in the reaction, yielding dihydrofolate (DHF) as a by-product. This enzymatic reaction provides an intracellular de novo source of dTMP, an essential precursor for DNA biosynthesis
Orthologous groupCOG0207
EC number EC 2.1.1.45
KEGG orthology K00560
KEGG pathways map00240, map00670, map01100, map01523
KEGG modules M00053
Gene Ontology (90) GO:0003674, GO:0003824, GO:0004799, GO:0006139, GO:0006220, GO:0006221, GO:0006231, GO:0006244, GO:0006725, GO:0006753, GO:0006793, GO:0006796 +78 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.934 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Thymidylat_syntPF00303.25 2.1e-1233–263 Thymidylate synthase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: dfrA (dihydrofolate reductase), high confidence from genomic context alone (score 998 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2763c dfrA dihydrofolate reductase 999 998 ctx neighborhood:793 cooccurence:774 coexpression:703 database:900 textmining:930
Rv2754c thyX thymidylate synthase ThyX 997 953 ctx neighborhood:551 database:900 textmining:953
Rv2697c dut deoxyuridine 5'-triphosphate nucleotidohydrolase 986 951 coexpression:445 database:900 textmining:739
Rv3356c folD bifunctional methylenetetrahydrofolate dehydrogenase/methenyltetrahydrofolate cyclohydrolase 965 924 database:900 textmining:565
Rv3247c tmk thymidylate kinase 940 918 database:900
Rv1093 glyA1 serine hydroxymethyltransferase 942 909 database:900
Rv0070c glyA2 serine hydroxymethyltransferase 942 908 database:900
Rv2211c gcvT aminomethyltransferase 928 905 database:900
Rv3214 gpm2 phosphoglycerate mutase 895 895 ctx fusion:890
Rv2447c folC folylpolyglutamate synthase FolC 985 801 database:800 textmining:929
Rv2762c hyp hypothetical protein 874 733 ctx neighborhood:730 textmining:548
Rv2902c rnhB ribonuclease HII 755 708 coexpression:652
Rv1407 fmu 16S rRNA m5C967 methyltransferase 720 708 coexpression:667
Rv3051c nrdE ribonucleoside-diphosphate reductase subunit alpha 699 671 coexpression:660
Rv0002 dnaN DNA polymerase III subunit beta 713 658 coexpression:602

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): thymidylate synthase ThyA
  • Pfam (hmmscan --cut_ga): Thymidylat_synt PF00303.25 (E=2e-123)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217280.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Thymidylat_synt (PF00303.25)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0207
  • Curated reference: UniProt P9WFR9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 85 functional partner(s); context anchor dfrA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2764c|thyA
MTPYEDLLRFVLETGTPKSDRTGTGTRSLFGQQMRYDLSAGFPLLTTKKVHFKSVAYELLWFLRGDSNIGWLHEHGVTIWDEWASDTGELGPIYGVQWRSWPAPSGEHIDQISAALDLLRTDPDSRRIIVSAWNVGEIERMALPPCHAFFQFYVADGRLSCQLYQRSADLFLGVPFNIASYALLTHMMAAQAGLSVGEFIWTGGDCHIYDNHVEQVRLQLSREPRPYPKLLLADRDSIFEYTYEDIVVKNYDPHPAIKAPVAV