Rv3788 Family assigned · medium auto-curated

H37Rv Rv3788 · MTBC0 mtbc0_004016 · 161 aa · 4258901–4259386 (+) · RefSeq NP_218305.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationGreA/GreB family elongation factor
Revised (this work)GreA/GreB family elongation factor. Pfam: GreA_GreB (PF01272.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKW7 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized protein Rv3788

UniProt still lists this protein as Uncharacterized protein Rv3788; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
eggNOG descriptionTranscription elongation factor, GreA/GreB, C-term
Orthologous groupCOG0782

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.923 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
GreA_GreBPF01272.26 2.0e-0989–158 Transcription elongation factor, GreA/GreB, C-term

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv3789 (GtrA family protein), high confidence from genomic context alone (score 777 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0668 rpoC DNA-directed RNA polymerase subunit beta' 956 944 coexpression:423 experimental:906
Rv0667 rpoB DNA-directed RNA polymerase subunit beta 938 913 experimental:905
Rv3457c rpoA DNA-directed RNA polymerase subunit alpha 915 905 experimental:895
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 910 898 experimental:892
Rv3789 GtrA family protein 776 777 ctx neighborhood:768
Rv1963c mce3R transcriptional repressor Mce3R 760 751 ctx cooccurence:747
Rv3790 dprE1 decaprenylphosphoryl-beta-D-ribose oxidase 744 745 ctx neighborhood:732
Rv3793 embC arabinosyltransferase C 736 736 ctx neighborhood:732
Rv3791 dprE2 decaprenylphosphoryl-D-2-keto erythropentose reductase 735 736 ctx neighborhood:732
Rv3792 aftA arabinofuranosyltransferase 733 734 ctx neighborhood:732
Rv0538 membrane protein 725 726 ctx cooccurence:724
Rv1775 hyp hypothetical protein 713 713 ctx cooccurence:713
Rv3903c cpnT hyp hypothetical protein 703 702 ctx cooccurence:700
Rv2113 integral membrane protein 673 674 ctx cooccurence:667
Rv1937 oxygenase 657 656 ctx cooccurence:627

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: GreA/GreB family elongation factor
  • Pfam (hmmscan --cut_ga): GreA_GreB PF01272.26 (E=2e-09)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_218305.1)
  • Domains: Pfam-A via hmmscan --cut_ga — GreA_GreB (PF01272.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0782
  • Curated reference: UniProt P9WKW7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 52 functional partner(s); context anchor Rv3789
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_004016|Rv3788|
MSEKVESKGLADAARDHLAAELARLRQRRDRLEVEVKNDRGMIGDHGDAAEAIQRADELAILGDRINELDRRLRTGPTPWSGSETLPGGTEVTLRFPDGEVVTMHVISVVEETPVGREAETLTARSPLGQALAGHQPGDTVTYSTPQGPNQVQLLAVKLPS