Rv1624c Family assigned · low auto-curated

H37Rv Rv1624c · MTBC0 mtbc0_001731 · 195 aa · 1837962–1838549 (-) · RefSeq NP_216140.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotationHdeD family acid-resistance protein
Revised (this work)HdeD family acid-resistance protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O06141 TrEMBL · unreviewed · Predicted
UniProt nameProbable conserved membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionShort repeat of unknown function (DUF308)
Orthologous groupCOG3247

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.369 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF308PF03729.19 1.0e-1130–99 Short repeat of unknown function (DUF308)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: cya (adenylate cyclase), high confidence from genomic context alone (score 842 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1625c cya adenylate cyclase 842 842 ctx neighborhood:840
Rv1623c cydA cytochrome D ubiquinol oxidase subunit I CydA 781 781 ctx neighborhood:768
Rv1622c cydB cytochrome D ubiquinol oxidase subunit II CydB 761 761 ctx neighborhood:743
Rv1621c cydD cytochrome biosyntheisis ABC transporter ATP-binding protein/permease CydD 691 691 ctx neighborhood:688
Rv1620c cydC cytochrome biosyntheisis ABC transporter ATP-binding protein/permease CydC 690 690 ctx neighborhood:688
Rv1811 mgtC Mg2+ transport P-type ATPase MgtC 689 659 coexpression:648
Rv3008 hyp hypothetical protein 687 657 coexpression:646
Rv3432c gadB glutamate decarboxylase GadB 624 593 coexpression:447
Rv0185 hyp hypothetical protein 522 522 ctx cooccurence:522
Rv3035 hyp hypothetical protein 489 490 ctx cooccurence:487
Rv1125 hyp hypothetical protein 468 469 ctx cooccurence:466
Rv3481c integral membrane protein 459 460 ctx cooccurence:458
Rv1626 pdtaR two-component system transcriptional regulator 449 448 ctx neighborhood:440
Rv0184 hyp hypothetical protein 434 434 ctx cooccurence:434
Rv1780 hyp hypothetical protein 431 432 ctx cooccurence:428

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: membrane protein
  • MTBC0 PGAP product: HdeD family acid-resistance protein
  • Pfam (hmmscan --cut_ga): DUF308 PF03729.19 (E=1e-11)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216140.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF308 (PF03729.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3247
  • Curated reference: UniProt O06141 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 21 functional partner(s); context anchor cya
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001731|Rv1624c|
MCHTAPMEPSPVVSPLPRLLPHLWKSTLASGILSLILGVLVLAWPGISILVAAMAFGVYLLITGVAQVAFAFSLHVSAGGRILLFISGAASLILAVLAFRHFGDAVLLLAIWIGIGFIFRGVATTVSAISDPMLPGRGWSIFVGVISLIAGIVVMASPFESIWILALVVGIWLVVIGACEIASSFAIRKASQTLG