Rv1626 Family assigned · medium auto-curated

H37Rv Rv1626 · MTBC0 mtbc0_001734 · 205 aa · 1840144–1840761 (+) · RefSeq NP_216142.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)two-component system transcriptional regulator
MTBC0 PGAP re-annotationANTAR domain-containing response regulator
Revised (this work)ANTAR domain-containing response regulator. Pfam: Response_reg (PF00072.31), ANTAR (PF03861.20).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGM3 SwissProt · reviewed · Evidence at protein level
UniProt nameTranscriptional regulatory protein PdtaR
Curated functionMember of the two-component regulatory system PdtaR/PdtaS. This two-component system plays an essential role in mycobacterial adaptation to poor nutrient conditions. PdtaR probably acts at the level of transcriptional antitermination rather than transcriptional initiation..; FUNCTION: In addition, the PdtaR/PdtaS two-component system controls copper and nitric oxide (NO) resistance downstream of the intramembrane protease Rip1. This coupled Rip1/PdtaS/PdtaR circuit controls NO resistance and acute lung infection in mice by relieving PdtaR/PdtaS-mediated repression of isonitrile chalkophore bio.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
Preferred namepdtaR
eggNOG descriptionresponse regulator
Orthologous groupCOG3707
KEGG orthology K22010
KEGG modules M00839
Gene Ontology (25) GO:0000160, GO:0003674, GO:0005488, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0007154, GO:0007165, GO:0008150, GO:0009987, GO:0016020 +13 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.33 · purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Response_regPF00072.31 1.9e-2916–125 Response regulator receiver domain
ANTARPF03861.20 4.0e-20144–195 ANTAR domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: pdtaS (two component sensor kinase), high confidence from genomic context alone (score 786 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1630 rpsA 30S ribosomal protein S1 821 795 coexpression:767
Rv3220c pdtaS two component sensor kinase 984 786 ctx cooccurence:756 textmining:928
Rv2239c hyp hypothetical protein 732 732 coexpression:732
Rv1310 atpD ATP synthase subunit beta 734 730 coexpression:730
Rv1311 atpC ATP synthase subunit epsilon 687 687 coexpression:687
Rv2199c ctaF cytochrome c oxidase polypeptide 4 651 651 coexpression:651
Rv3859c gltB glutamate synthase large subunit 637 587 ctx neighborhood:544
Rv0491 regX3 two component sensory transduction protein RegX 594 515 ctx cooccurence:489
Rv1625c cya adenylate cyclase 508 508 ctx neighborhood:503
Rv2920c amt ammonium transporter integral membrane protein 528 461 coexpression:417
Rv0831c hyp hypothetical protein 457 458 coexpression:458
Rv1611 trpC indole-3-glycerol phosphate synthase 453 453
Rv1624c membrane protein 449 448 ctx neighborhood:440
Rv0758 phoR two component system response sensor kinase PhoR 480 404 ctx cooccurence:400
Rv2847c cysG multifunctional uroporphyrin-III C-methyltransferase/precorrin-2 oxidase/ferrochelatase 537 371

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: two-component system transcriptional regulator
  • MTBC0 PGAP product: ANTAR domain-containing response regulator
  • Pfam (hmmscan --cut_ga): Response_reg PF00072.31 (E=2e-29), ANTAR PF03861.20 (E=4e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216142.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Response_reg (PF00072.31), ANTAR (PF03861.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3707
  • Curated reference: UniProt P9WGM3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 33 functional partner(s); context anchor pdtaS
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001734|Rv1626|
MTGPTTDADAAVPRRVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEGEVATLSERLETRKLVERAKGLLQTKHGMTEPDAFKWIQRAAMDRRTTMKRVAEVVLETLGTPKDT