Rv1626 Family assigned · medium auto-curated
H37Rv Rv1626 · MTBC0 mtbc0_001734 ·
205 aa ·
1840144–1840761 MTBC0
(+) ·
RefSeq NP_216142.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | two-component system transcriptional regulator |
|---|---|
| MTBC0 PGAP re-annotation | ANTAR domain-containing response regulator |
| Revised (this work) | ANTAR domain-containing response regulator. Pfam: Response_reg (PF00072.31), ANTAR (PF03861.20). |
| Functional category (TubercuList) | regulatory proteins |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
In the literature (TB corpus sweep) 9 publications
9 TB publications mention this gene. 9 publication(s) discuss this gene (8 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| Use Intein Cleavable Polyhydroxyalkanoate Synthase Fusions to Improve Protein Solubility. doi:10.1007/978-1-0716-1859-2_8 | 2022 |
| Cyclic di-GMP sensing histidine kinase PdtaS controls mycobacterial adaptation to carbon sources. doi:10.1096/fj.202002537RR | 2021 |
| Purification of target proteins from intracellular inclusions mediated by intein cleavable polyhydroxyalkanoate synthase fusions. doi:10.1186/s12934-017-0799-1 | 2017 |
| Immunological properties and protective efficacy of a single mycobacterial antigen displayed on polyhydroxybutyrate beads. doi:10.1111/1751-7915.12754 | 2017 |
| Immunogencity of antigens from Mycobacterium tuberculosis self-assembled as particulate vaccines. doi:10.1016/j.ijmm.2016.10.002 | 2016 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Post-translational modifications
2 reported modified residue(s):
N-acetylthreonine @2, 4-aspartylphosphate @65.
Experimentally reported post-translational modification(s). A phosphosite indicates the protein is expressed and is a substrate of the M. tuberculosis Ser/Thr/Tyr kinase signalling network — a regulatory context, NOT a molecular function. Source: UniProt (Modified residue features; PTM sites curated from the M. tuberculosis literature).
CRISPRi vulnerability
Vulnerability index -1.11 (95% CI -1.99 to 0.10). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Sensor part of a two component regulatory system |
|---|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb1652
· 100.0% identity |
|---|---|
| M. leprae |
ML1286
· 90.7% identity |
| M. marinum |
MMAR_2429
· 91.7% identity |
| M. smegmatis |
MSMEG_3246
· 87.2% identity |
| M. orygis |
RJtmp_001700
· 100.0% identity |
| M. abscessus |
MAB_2627c
· 81.6% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WGM3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Transcriptional regulatory protein PdtaR |
| Curated function | Member of the two-component regulatory system PdtaR/PdtaS. This two-component system plays an essential role in mycobacterial adaptation to poor nutrient conditions. PdtaR probably acts at the level of transcriptional antitermination rather than transcriptional initiation..; FUNCTION: In addition, the PdtaR/PdtaS two-component system controls copper and nitric oxide (NO) resistance downstream of the intramembrane protease Rip1. This coupled Rip1/PdtaS/PdtaR circuit controls NO resistance and acute lung infection in mice by relieving PdtaR/PdtaS-mediated repression of isonitrile chalkophore bio. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
T Signal transduction mechanisms
|
|---|---|
| Preferred name | pdtaR |
| eggNOG description | response regulator |
| Orthologous group | COG3707 |
| KEGG orthology |
K22010
|
| KEGG modules |
M00839
|
| Gene Ontology (25) |
GO:0000160, GO:0003674, GO:0005488, GO:0005575, GO:0005618, GO:0005623, GO:0005886, GO:0007154, GO:0007165, GO:0008150, GO:0009987, GO:0016020 +13 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.33 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 91.9%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
|---|---|
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 59.4% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) cholesterol-required
| DeJesus 2017 call | NE · non-essential |
|---|---|
| What the call means | non-essential |
| TA sites (Himar1) | 5 in the ORF — 0 in the essential state, 0 growth-defect, 5 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 71.8. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
| Caveat | Read with some caution: only 5 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 5 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3) |
| Cholesterol catabolism | required for growth on cholesterol (Griffin 2011) |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype
| Condition | log2FC | q | Effect |
|---|---|---|---|
| fitness on cholesterol (vs glycerol) (carbon source) | -6.56 | 0.0 | required |
| altered fitness under Isoniazid (drug exposure) | +5.07 | 0.0 | disruption advantageous |
| altered fitness under Isoniazid (drug exposure) | +4.46 | 0.032 | disruption advantageous |
| altered fitness under acid stress in phosphate-citrate buffer (stress) | -4.35 | 0.0 | required |
| fitness in mouse infection (in vivo) | +3.46 | 0.018 | disruption advantageous |
| fitness in mouse infection (in vivo) | +3.43 | 0.021 | disruption advantageous |
| fitness in mouse infection, day 10 (in vivo) | +3.32 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +3.01 | 0.0083 | disruption advantageous |
| fitness in mouse infection (in vivo) | +2.91 | 0.016 | disruption advantageous |
| altered fitness under 6 weeks hypoxia (stress) | -2.81 | 0.0 | required |
| fitness in mouse infection (in vivo) | +2.76 | 0.0 | disruption advantageous |
| fitness in mouse infection (in vivo) | +2.73 | 0.0 | disruption advantageous |
Conditional fitness of transposon-disruption mutants across 21 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.
Proteomics (mass spectrometry) detected
| MS detection | detected in 16 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 1165.0 ppm · rank 188/3519 (94.7th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 205 aa |
|---|---|
| Molecular weight | 22.7 kDa |
| Theoretical pI | 5.02 |
| GRAVY | -0.163 (hydrophilic) |
| Aliphatic index | 98.6 |
| Aromaticity | 0.034 |
| Instability index | 36.5 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Response_reg | PF00072.31 | 1.9e-29 | 16–125 | Response regulator receiver domain |
ANTAR | PF03861.20 | 4.0e-20 | 144–195 | ANTAR domain |
Experimental structures (Protein Data Bank) 2 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
1s8n |
X-ray diffraction | 1.482 Å | 100% |
1sd5 |
X-ray diffraction | 1.68 Å | 100% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (2 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 88.9
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
1sd5-assembly1_A |
1.00 | 0.67 | 1.3e-27 sig | 1sd5-assembly1_A Crystal structure of Rv1626 |
6ww6-assembly1_A |
1.00 | 0.91 | 7.1e-19 sig | 6ww6-assembly1_A Crystal structure of EutV bound to RNA |
4qyw-assembly1_A |
1.00 | 0.91 | 1.8e-10 sig | 4qyw-assembly1_A Structure of phosphono-CheY from T.maritima |
8fk2-assembly1_B |
1.00 | 0.90 | 3.1e-10 sig | 8fk2-assembly1_B The N-terminal VicR from Streptococcus mutans |
4kfc-assembly1_A |
1.00 | 0.91 | 5.0e-10 sig | 4kfc-assembly1_A Crystal structure of a hyperactive mutant of response regulator KdpE complexed to its promoter DNA |
Foldseek search of the AlphaFold DB model (mean pLDDT 88.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon)
| Upstream (5' on genome) | leuV (- strand, 91 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv1627c (- strand, 67 bp gap) |
Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: pdtaS (two component sensor kinase), high confidence from genomic context alone (score 786 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1630 rpsA |
30S ribosomal protein S1 | 821 | 795 | coexpression:767 |
Rv3220c pdtaS |
two component sensor kinase | 984 | 786 ctx | cooccurence:756 textmining:928 |
Rv2239c hyp |
hypothetical protein | 732 | 732 | coexpression:732 |
Rv1310 atpD |
ATP synthase subunit beta | 734 | 730 | coexpression:730 |
Rv1311 atpC |
ATP synthase subunit epsilon | 687 | 687 | coexpression:687 |
Rv2199c ctaF |
cytochrome c oxidase polypeptide 4 | 651 | 651 | coexpression:651 |
Rv3859c gltB |
glutamate synthase large subunit | 637 | 587 ctx | neighborhood:544 |
Rv0491 regX3 |
two component sensory transduction protein RegX | 594 | 515 ctx | cooccurence:489 |
Rv1625c cya |
adenylate cyclase | 508 | 508 ctx | neighborhood:503 |
Rv2920c amt |
ammonium transporter integral membrane protein | 528 | 461 | coexpression:417 |
Rv0831c hyp |
hypothetical protein | 457 | 458 | coexpression:458 |
Rv1611 trpC |
indole-3-glycerol phosphate synthase | 453 | 453 | |
Rv1624c |
membrane protein | 449 | 448 ctx | neighborhood:440 |
Rv0758 phoR |
two component system response sensor kinase PhoR | 480 | 404 ctx | cooccurence:400 |
Rv2847c cysG |
multifunctional uroporphyrin-III C-methyltransferase/precorrin-2 oxidase/ferrochelatase | 537 | 371 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: two-component system transcriptional regulator
- MTBC0 PGAP product: ANTAR domain-containing response regulator
- Pfam (hmmscan --cut_ga): Response_reg PF00072.31 (E=2e-29), ANTAR PF03861.20 (E=4e-20)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216142.1)
- Domains: Pfam-A via hmmscan --cut_ga — Response_reg (PF00072.31), ANTAR (PF03861.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG3707 - Curated reference: UniProt P9WGM3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 88.9)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
33 functional partner(s); context anchor
pdtaS - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY); cholesterol requirement from Griffin et al. 2011 (doi:10.1371/journal.ppat.1002251)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001734|Rv1626| MTGPTTDADAAVPRRVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEGEVATLSERLETRKLVERAKGLLQTKHGMTEPDAFKWIQRAAMDRRTTMKRVAEVVLETLGTPKDT
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for Rv1626? Email the maintainer — the message is pre-filled with this gene's details.