Rv1531 Family assigned · medium auto-curated

H37Rv Rv1531 · MTBC0 mtbc0_001638 · 188 aa · 1742282–1742848 (+) · RefSeq NP_216047.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationcarboxymuconolactone decarboxylase family protein
Revised (this work)Carboxymuconolactone decarboxylase family protein. Pfam: CMD (PF02627.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53905 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptioncarboxymuconolactone decarboxylase
Orthologous groupCOG2128

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CMDPF02627.26 1.6e-1740–122 Carboxymuconolactone decarboxylase family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: adh (alcohol dehydrogenase), high confidence from genomic context alone (score 833 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1530 adh alcohol dehydrogenase 833 833 ctx neighborhood:801
Rv2423 hyp hypothetical protein 542 542 ctx cooccurence:540
Rv2067c hyp hypothetical protein 536 537 ctx cooccurence:534
Rv1529 fadD24 fatty-acid--CoA ligase FadD24 524 525 ctx neighborhood:513
Rv0943c monooxygenase 524 524 ctx cooccurence:512
Rv3899c hyp hypothetical protein 495 495 ctx cooccurence:491
Rv1286 cysC adenylyl-sulfate kinase 476 476 coexpression:476
Rv3060c GntR family transcriptional regulator 452 452 ctx cooccurence:452
Rv3435c transmembrane protein 541 448 ctx cooccurence:448
Rv1868 hyp hypothetical protein 432 433 ctx cooccurence:431
Rv3773c hyp hypothetical protein 408 408 ctx cooccurence:407
Rv2399c cysT sulfate ABC transporter permease CysT 403 404 coexpression:404
Rv0433 carboxylate-amine ligase 402 402 coexpression:402
Rv0771 4-carboxymuconolactone decarboxylase 668 205 textmining:600
Rv3833 AraC family transcriptional regulator 483 130 textmining:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: carboxymuconolactone decarboxylase family protein
  • Pfam (hmmscan --cut_ga): CMD PF02627.26 (E=2e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216047.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CMD (PF02627.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2128
  • Curated reference: UniProt O53905 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 36 functional partner(s); context anchor adh
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001638|Rv1531|
MTTSRVPLLPVDEAKAAADEAGVPDYMAELSIFQVLLNHPRLARTFNDLLATMLWHGTLDSRLRELVIMRIGWLTDCDYEWTQHWRVASGLGVSADDLLGVRDWQGYNGFGPAEQAVLAATDDVVREGAVSAQSWSACERELHCDKVVLIELVTVISAWRMVASILHSLEVPLEDGVSSWPPDGLSPR