adh Resolved · high auto-curated
H37Rv Rv1530 · MTBC0 mtbc0_001637 ·
367 aa · 1741182–1742285 (+) ·
RefSeq NP_216046.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | alcohol dehydrogenase |
|---|---|
| MTBC0 PGAP re-annotation | zinc-binding dehydrogenase |
| Revised (this work) | Zinc-binding dehydrogenase. Pfam: ADH_N (PF08240.18), ADH_zinc_N (PF00107.33). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WQC3
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable alcohol dehydrogenase adh |
| EC (curated) |
EC 1.1.1.1
|
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
C Energy production and conversion
|
|---|---|
| Preferred name | adh |
| eggNOG description | alcohol dehydrogenase |
| Orthologous group | COG1063 |
| EC number |
EC 1.1.1.1, EC 1.1.1.14
|
| KEGG orthology |
K00001, K00008
|
| KEGG pathways |
map00010, map00040, map00051, map00071, map00350, map00625, map00626, map00830, map00980, map00982, map01100, map01110, map01120, map01130, map01220
|
| KEGG modules |
M00014
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.668 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 7 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.12% of strains (171) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
ADH_N | PF08240.18 | 1.1e-22 | 29–147 | Alcohol dehydrogenase GroES-like domain |
ADH_zinc_N | PF00107.33 | 1.7e-20 | 193–325 | Zinc-binding dehydrogenase |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv3726 (dehydrogenase), high confidence from genomic context alone (score 739 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0223c |
aldehyde dehydrogenase | 924 | 920 | database:900 |
Rv3293 pcd |
piperideine-6-carboxylic acid dehydrogenase | 924 | 920 | database:900 |
Rv0768 aldA |
aldehyde dehydrogenase AldA | 924 | 920 | database:900 |
Rv0458 |
aldehyde dehydrogenase | 924 | 920 | database:900 |
Rv0147 |
aldehyde dehydrogenase | 923 | 920 | database:900 |
Rv3170 aofH |
flavin-containing monoamine oxidase | 913 | 908 | database:900 |
Rv1703c |
methyltransferase | 904 | 905 | database:900 |
Rv1833c dhmA2 |
haloalkane dehalogenase | 906 | 903 | database:900 |
Rv2579 dhaA |
haloalkane dehalogenase | 906 | 902 | database:900 |
Rv2296 dhmA1 |
haloalkane dehalogenase | 906 | 902 | database:900 |
Rv3252c alkB |
transmembrane alkane 1-monooxygenase AlkB | 904 | 901 | database:900 |
Rv1531 hyp |
hypothetical protein | 833 | 833 ctx | neighborhood:801 |
Rv3726 |
dehydrogenase | 738 | 739 ctx | cooccurence:738 |
Rv1529 fadD24 |
fatty-acid--CoA ligase FadD24 | 527 | 528 ctx | neighborhood:517 |
Rv1862 adhA |
alcohol dehydrogenase A | 482 | 457 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: alcohol dehydrogenase
- MTBC0 PGAP product: zinc-binding dehydrogenase
- Pfam (hmmscan --cut_ga): ADH_N PF08240.18 (E=1e-22), ADH_zinc_N PF00107.33 (E=2e-20)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216046.1)
- Domains: Pfam-A via hmmscan --cut_ga — ADH_N (PF08240.18), ADH_zinc_N (PF00107.33)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1063 - Curated reference: UniProt P9WQC3 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
40 functional partner(s); context anchor
Rv3726 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001637|Rv1530|adh MSDGAVVRALVLEAPRRLVVRQYRLPRIGDDDALVRVEACGLCGTDHEQYTGELAGGFAFVPGHETVGTIAAIGPRAEQRWGVSAGDRVAVEVFQSCRQCANCRGGEYRRCVRHGLADMYGFIPVDREPGLWGGYAEYQYLAPDSMVLRVAGDLSPEVATLFNPLGAGIRWGVTIPETKPGDVVAVLGPGIRGLCAAAAAKGAGAGFVMVTGLGPRDADRLALAAQFGADLAVDVAIDDPVAALTEQTGGLADVVVDVTAKAPAAFAQAIALARPAGTVVVAGTRGVGSGAPGFSPDVVVFKELRVLGALGVDATAYRAALDLLVSGRYPFASLPRRCVRLEGAEDLLATMAGERDGVPPIHGVLTP