adh Resolved · high auto-curated

H37Rv Rv1530 · MTBC0 mtbc0_001637 · 367 aa · 1741182–1742285 MTBC0 (+) · RefSeq NP_216046.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)alcohol dehydrogenase
MTBC0 PGAP re-annotationzinc-binding dehydrogenase
Revised (this work)Zinc-binding dehydrogenase. Pfam: ADH_N (PF08240.18), ADH_zinc_N (PF00107.33).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 30 publications

30 TB publications mention this gene. 30 publication(s) discuss this gene (24 in a M. tuberculosis context, 4 in other mycobacteria — M. smegmatis (3)).

Most recent 4 of 30.
PublicationDate
Discovery of alcohol dehydrogenase (ADH) as a potential vaccine target from Mycolicibacterium smegmatis extracellular vesicles via immunoproteomics. doi:10.47665/tb.42.2.014 2025
Bienzymatic Dynamic Kinetic Resolution of Secondary Alcohols by Esterification/Racemization in Water. doi:10.1002/anie.202420133 2025
Breath Analysis for Lung Cancer Early Detection-A Clinical Study. doi:10.3390/metabo13121197 2023
Associations of hyponatremia and SIADH with increased mortality, young age and infection parameters in patients with tuberculosis. doi:10.1371/journal.pone.0275827 2022

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Genomic-neighbour overlap (structural caveat) co-directional · 0 % of gene

NeighbourRv1531 (Rv1531, + strand)
Overlap4 bp, 0 % of this gene's length

co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.

CRISPRi vulnerability

Vulnerability index -0.22 (95% CI -4.07 to 4.16). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionCatalyzes the reversible oxidation of ethanol to acetaldehyde with the concomitant reduction of NAD
Mycobrowser EC 1.1.1.1 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb1557 · 100.0% identity
M. marinum MMAR_3163 · 58.5% identity
M. smegmatis MSMEG_3265 · 31.6% identity
M. orygis RJtmp_001617 · 100.0% identity
M. abscessus MAB_2041c · 59.6% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WQC3 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable alcohol dehydrogenase adh
EC (curated) EC 1.1.1.1

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category C Energy production and conversion
Preferred nameadh
eggNOG descriptionalcohol dehydrogenase
Orthologous groupCOG1063
EC number EC 1.1.1.1, EC 1.1.1.14
KEGG orthology K00001, K00008
KEGG pathways map00010, map00040, map00051, map00071, map00350, map00625, map00626, map00830, map00980, map00982, map01100, map01110, map01120, map01130, map01220
KEGG modules M00014

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.668 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 7 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.12% of strains (171) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 31/53 (58%) · mean identity 67.0% · 4/4 closest MTBAP relatives
conserved across the genus (present in 31/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 9/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 35.3%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 25 in the ORF — 0 in the essential state, 0 growth-defect, 25 non-essential, 0 growth-advantage. Saturation 0.920, mean read count 38.5217391304. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection, day 45 (in vivo) -2.740.002 required
Differential genetic requirements of clinical Mtb strain (ID=662) from East Asian lineage (compared to H37Rv control) (strain background) +2.110.025 required

Conditional fitness of transposon-disruption mutants across 2 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 9 of 16 independent MS datasets
Integrated abundance66.2 ppm · rank 1573/3519 (55.3th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length367 aa
Molecular weight38.0 kDa
Theoretical pI5.26
GRAVY0.239 (hydrophobic)
Aliphatic index97.1
Aromaticity0.063
Instability index26.7 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
ADH_NPF08240.18 1.1e-2229–147 Alcohol dehydrogenase GroES-like domain
ADH_zinc_NPF00107.33 1.7e-20193–325 Zinc-binding dehydrogenase

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 95.7

PDB hitprobTM-scoreE-valueDescription
4ejm-assembly1_A 1.00 0.90 5.0e-31 sig 4ejm-assembly1_A Crystal structure of a putative zinc-binding dehydrogenase (Target PSI-012003) from Sinorhizobium meliloti 1021 bound to NADP
4cpd-assembly2_B 1.00 0.87 1.4e-30 sig 4cpd-assembly2_B Alcohol dehydrogenase TADH from Thermus sp. ATN1
1vj0-assembly1_D 1.00 0.87 2.1e-29 sig 1vj0-assembly1_D Crystal structure of Alcohol dehydrogenase (TM0436) from Thermotoga maritima at 2.00 A resolution
4cpd-assembly2_C 1.00 0.88 1.9e-29 sig 4cpd-assembly2_C Alcohol dehydrogenase TADH from Thermus sp. ATN1
4cpd-assembly1_D 1.00 0.86 3.4e-27 sig 4cpd-assembly1_D Alcohol dehydrogenase TADH from Thermus sp. ATN1

Foldseek search of the AlphaFold DB model (mean pLDDT 95.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)fadD24 (+ strand, 116 bp gap)
Downstream (3' on genome)Rv1531 (+ strand, -4 bp gap)
Predicted operon adh · Rv1531

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv3726 (dehydrogenase), high confidence from genomic context alone (score 739 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0223c exp aldehyde dehydrogenase 924 920 database:900
Rv3293 pcd exp piperideine-6-carboxylic acid dehydrogenase 924 920 database:900
Rv0768 aldA exp aldehyde dehydrogenase AldA 924 920 database:900
Rv0458 exp aldehyde dehydrogenase 924 920 database:900
Rv0147 exp aldehyde dehydrogenase 923 920 database:900
Rv3170 aofH exp flavin-containing monoamine oxidase 913 908 database:900
Rv1703c exp methyltransferase 904 905 database:900
Rv1833c dhmA2 exp haloalkane dehalogenase 906 903 database:900
Rv2579 dhaA exp haloalkane dehalogenase 906 902 database:900
Rv2296 dhmA1 exp haloalkane dehalogenase 906 902 database:900
Rv3252c alkB exp transmembrane alkane 1-monooxygenase AlkB 904 901 database:900
Rv1531 hyp hypothetical protein 833 833 ctx neighborhood:801
Rv3726 dehydrogenase 738 739 ctx cooccurence:738
Rv1529 fadD24 fatty-acid--CoA ligase FadD24 527 528 ctx neighborhood:517
Rv1862 adhA alcohol dehydrogenase A 482 457

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: alcohol dehydrogenase
  • MTBC0 PGAP product: zinc-binding dehydrogenase
  • Pfam (hmmscan --cut_ga): ADH_N PF08240.18 (E=1e-22), ADH_zinc_N PF00107.33 (E=2e-20)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216046.1)
  • Domains: Pfam-A via hmmscan --cut_ga — ADH_N (PF08240.18), ADH_zinc_N (PF00107.33)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1063
  • Curated reference: UniProt P9WQC3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 95.7)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 40 functional partner(s); context anchor Rv3726
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001637|Rv1530|adh
MSDGAVVRALVLEAPRRLVVRQYRLPRIGDDDALVRVEACGLCGTDHEQYTGELAGGFAFVPGHETVGTIAAIGPRAEQRWGVSAGDRVAVEVFQSCRQCANCRGGEYRRCVRHGLADMYGFIPVDREPGLWGGYAEYQYLAPDSMVLRVAGDLSPEVATLFNPLGAGIRWGVTIPETKPGDVVAVLGPGIRGLCAAAAAKGAGAGFVMVTGLGPRDADRLALAAQFGADLAVDVAIDDPVAALTEQTGGLADVVVDVTAKAPAAFAQAIALARPAGTVVVAGTRGVGSGAPGFSPDVVVFKELRVLGALGVDATAYRAALDLLVSGRYPFASLPRRCVRLEGAEDLLATMAGERDGVPPIHGVLTP