lspA Resolved · high auto-curated

H37Rv Rv1539 · MTBC0 mtbc0_001646 · 202 aa · 1752053–1752661 (+) · RefSeq NP_216055.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein signal peptidase
MTBC0 PGAP re-annotationsignal peptidase II
Revised (this work)Signal peptidase II. Pfam: Peptidase_A8 (PF01252.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WK99 SwissProt · reviewed · Evidence at protein level
UniProt nameLipoprotein signal peptidase
EC (curated) EC 3.4.23.36
Curated functionThis protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category M Cell wall / membrane / envelope biogenesis
U Intracellular trafficking, secretion and vesicular transport
Preferred namelspA
eggNOG descriptionThis protein specifically catalyzes the removal of signal peptides from prolipoproteins
Orthologous groupCOG0597
EC number EC 3.4.23.36
KEGG orthology K03101
KEGG pathways map03060
Gene Ontology (28) GO:0006464, GO:0006497, GO:0006807, GO:0008150, GO:0008152, GO:0009058, GO:0009059, GO:0009405, GO:0009987, GO:0019538, GO:0034645, GO:0036211 +16 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.194 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Peptidase_A8PF01252.24 3.0e-3239–178 Signal peptidase (SPase) II

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1540 (RNA pseudouridine synthase), high confidence from genomic context alone (score 910 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1540 RNA pseudouridine synthase 909 910 ctx neighborhood:881
Rv1538c ansA L-aparaginase 809 789 ctx neighborhood:788
Rv2838c rbfA ribosome-binding factor RbfA 640 617 coexpression:412
Rv1536 ileS isoleucine--tRNA ligase 583 537 coexpression:473
Rv2154c ftsW lipid II flippase FtsW 497 466
Rv1614 lgt prolipoprotein diacylglyceryl transferase 833 458 ctx cooccurence:407 textmining:706
Rv1709 scpA segregation and condensation protein ScpA 465 441
Rv1650 pheT phenylalanine--tRNA ligase subunit beta 433 433 coexpression:400
Rv1112 ychF GTP-binding protein 422 423 coexpression:422
Rv1225c hyp hypothetical protein 409 410
Rv3423c alr alanine racemase 406 407
Rv1692 phosphatase 406 406
Rv2157c murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase 411 378
Rv1407 fmu 16S rRNA m5C967 methyltransferase 401 373
Rv1710 scpB segregation and condensation protein ScpB 481 323

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein signal peptidase
  • MTBC0 PGAP product: signal peptidase II
  • Pfam (hmmscan --cut_ga): Peptidase_A8 PF01252.24 (E=3e-32)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216055.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Peptidase_A8 (PF01252.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0597
  • Curated reference: UniProt P9WK99 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 34 functional partner(s); context anchor Rv1540
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001646|Rv1539|lspA
MPDEPTGSADPLTSTEEAGGAGEPNAPAPPRRLRMLLSVAVVVLTLDIVTKVVAVQLLPPGQPVSIIGDTVTWTLVRNSGAAFSMATGYTWVLTLIATGVVVGIFWMGRRLVSPWWALGLGMILGGAMGNLVDRFFRAPGPLRGHVVDFLSVGWWPVFNVADPSVVGGAILLVILSIFGFDFDTVGRRHADGDTVGRRKADG