Rv0943c Still unknown · low auto-curated

H37Rv Rv0943c · MTBC0 mtbc0_001002 · 31 aa · 1057167–1057259 (+) · RefSeq NP_215458.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)monooxygenase
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WKN7 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv0943c

UniProt still lists this protein as Uncharacterized protein Rv0943c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
eggNOG descriptionDomain of unknown function (DUF4873)
Orthologous groupCOG2072
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.823 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 6 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.34% of strains (494) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0945 (oxidoreductase), medium confidence from genomic context alone (score 637 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0945 oxidoreductase 914 637 ctx neighborhood:590 textmining:774
Rv0944 fpg2 formamidopyrimidine-DNA glycosylase 924 620 ctx neighborhood:618 textmining:808
Rv3083 mymA FAD-containing monooxygenase MymA 608 608 ctx cooccurence:608
Rv0565c monooxygenase 582 582 ctx cooccurence:580
Rv1868 hyp hypothetical protein 564 564 ctx cooccurence:452
Rv3854c ethA monooxygenase EthA 558 558 ctx cooccurence:558
Rv1531 hyp hypothetical protein 524 524 ctx cooccurence:512
Rv2047c hyp hypothetical protein 496 496
Rv3097c lipY triacylglycerol lipase Lip 489 487 ctx cooccurence:443
Rv3638 transposase 474 474 coexpression:474
Rv1006 hyp hypothetical protein 452 452 ctx cooccurence:449
Rv1308 atpA ATP synthase subunit alpha 436 437 experimental:427
Rv1309 atpG ATP synthase subunit gamma 412 412
Rv3456c rplQ 50S ribosomal protein L17 409 410
Rv1507c hyp hypothetical protein 409 409

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: monooxygenase
  • MTBC0 PGAP product: hypothetical protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215458.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2072
  • Curated reference: UniProt P9WKN7 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 32 functional partner(s); context anchor Rv0945
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001002|Rv0943c|
MAGVSEAERRGHRKLVRFQARRAIGPIRPTS