Rv0943c Still unknown · low auto-curated

H37Rv Rv0943c · MTBC0 mtbc0_001002 · 31 aa · 1057167–1057259 MTBC0 (+) · RefSeq NP_215458.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)monooxygenase
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)Conserved hypothetical protein; no recognised domain. Function unknown.
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) never studied

No TB publication mentions this locus tag in its title or abstract (sweep of a ~330k-abstract PubMed TB corpus). This gene is genuinely unstudied: its darkness reflects absence of investigation, not failure of investigation.

An antigen status or a virulence phenotype is NOT a molecular function: the verdict stays unchanged. This layer adds the missing context, it does not requalify the gene. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole), MULTI-ALIAS sweep of title+abstract: the H37Rv locus tag AND every ortholog identifier (M. bovis Mb…, M. marinum MMAR_…, M. smegmatis MSMEG_…, M. leprae ML…, M. abscessus MAB_…), each hit VERIFIED against the abstract text (word-boundary regex). phase73, 2026-07-13.

Intrinsic disorder (sequence + structure) highly disordered

Predicted disorder100% of residues (metapredict) · mean AlphaFold pLDDT 71.8
Disordered regions1 IDR(s), longest 31 aa [0-31]

sequence-based disorder is high but AlphaFold folds it confidently (pLDDT>=70): treat the disorder call with caution (possible metapredict over-call)

A property (biophysics), not a function. No LLPS/condensate claim is made from disorder alone. Verdict unchanged. Source: metapredict v3 (Emenecker/Holehouse) per-residue disorder + AlphaFold mean pLDDT (annotation_mtbc P16.13).

Integrative functional lead (multi-layer synthesis, hypothesis) 1 convergent handles

candidate FAD-containing monooxygenase (family-level, EC undetermined), to validate

Convergent evidenceFoldseek SIGNIFICANT fold match (sig=True) to cyclohexanone monooxygenase, independently in two PDB entries (6era, 5m10) -- consistent with the pre-existing Mycobrowser guess ('Probable monooxygenase... probably involved in cellular metabolism')
Real-gene supportconservation relaxed/neutral (pN/pS 0.823, snp_sites=10/145209), MS-detected (1 dataset), predicted secreted (signal peptide). NOTE: the declared length (31 aa) is stale in this fiche's metadata -- the AlphaFold model actually analysed has 346 residues (cf. P16.3e length-mismatch guard); all structural evidence above uses the real 346-aa model.
Adversarial checkSTRING places it in cooccurrence with the characterised monooxygenases MymA (Rv3083) and EthA (Rv3854c), but this channel alone is NOT a reliable handle by this project's own bar (cf. phase44: only experimental/database >=300 counts for a flip) -- kept as corroborating context, not counted as a second independent handle. No confident P2Rank pocket was found (best probability 0.202, informative-zone calibration): true monooxygenases usually have a substrate pocket, so this is a genuine caveat, though ~40% of proven enzymes at this size ALSO miss the confidence threshold (P16.3b), making the absence inconclusive rather than contradictory. The pre-existing Mycobrowser guess is not counted as independent (may share the same structural origin). Kept at family level, no specific substrate/EC asserted.

Synthesised across all evidence layers (conservation, operon, STRING, regulon, phenotype, localisation, structure, vulnerability) under an anti-oversell decision checklist. A functional hypothesis to validate, not an established function. P16.3j individual dossier cross-reference, 2026-08-03.

Binding-pocket screen (P2Rank, geometric prediction) no confident pocket

Pockets found4 (best probability 0.202)
Model length screened346 aa

Read with care. This protein (346 aa) is above the size where the detector reliably differentiates proven enzymes (60.5% confident-pocket rate) from proteins annotated as non-catalytic (18.9%; P16.3b calibration). 4 candidate pocket(s) were found but none reached confidence (best probability 0.202), which is consistent with a non-catalytic role, though it does not rule out a shallow or non-canonical binding site that this geometric detector misses. (Individual read at this confidence level; the GROUP-level dark-vs-non-catalytic contrast is NOT statistically significant at this size, p=0.285 -- read as modest evidence, not proof, cf. P16.3c.) (Note: the declared gene length is 31 aa, but the analysed AlphaFold model has 346 residues -- the zone above uses the model's actual length, not the declared one.) P16.3e, calibration phase72b_pocket_calibration.py, 2026-08-03.

CRISPRi vulnerability

Vulnerability index 1.39 (95% CI -0.74 to 4.65). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionFunction unknown; probably involved in cellular metabolism.

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0968c · 99.7% identity
M. marinum MMAR_4565 · 63.2% identity
M. orygis RJtmp_000996 · 99.4% identity
M. abscessus MAB_1034c · 46.2% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WKN7 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv0943c

UniProt still lists this protein as Uncharacterized protein Rv0943c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
eggNOG descriptionDomain of unknown function (DUF4873)
Orthologous groupCOG2072
Gene Ontology (6) GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.823 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 6 missense, 1 nonsense, 0 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.34% of strains (494) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Mycobacterium

M. canettii dN/dS (deep-divergence selection) inf (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 25/53 (47%) · mean identity 77.2% · 2/4 closest MTBAP relatives
present in a subset of the genus (25/53 NTM; in 2 of the 4 closest MTBAP relatives) — partial/intermediate conservation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria

short ORF (31 aa) a shallow stratum may reflect homology-detection failure, not true youth
present across the genus Mycobacterium (NTM) but not detected in any non-Mycobacterium genome — a Mycobacterium-genus gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 17 in the ORF — 0 in the essential state, 0 growth-defect, 17 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 117.411764706. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 1 of 16 independent MS datasets
Integrated abundance3.29 ppm · rank 3072/3519 (12.7th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Predicted localisation (DeepTMHMM + lipobox) signal peptide

Predictionpredicted secreted protein (signal peptide)
DeepTMHMM classSP

Transmembrane topology and signal peptide from DeepTMHMM (deep-learning reference predictor); lipoproteins from a (myco)bacterial lipobox motif. A sequence-based prediction of subcellular context.

Physico-chemical properties (computed, ProtParam)

Length31 aa
Molecular weight3.5 kDa
Theoretical pI12.0
GRAVY-0.732 (hydrophilic)
Aliphatic index69.4
Aromaticity0.032
Instability index57.6 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 71.8

PDB hitprobTM-scoreE-valueDescription
6era-assembly2_B 1.00 0.37 3.0e-09 sig 6era-assembly2_B Crystal structure of cyclohexanone monooxygenase mutant (F249A, F280A and F435A) from Rhodococcus sp. Phi1 bound to NADP+
5m10-assembly1_A 1.00 0.36 3.1e-09 sig 5m10-assembly1_A Crystal structure of cyclohexanone monooxygenase from Thermocrispum municipale in the oxidised state with a bound nicotinamide.
3ucl-assembly1_A 1.00 0.37 5.4e-09 sig 3ucl-assembly1_A Cyclohexanone-bound crystal structure of cyclohexanone monooxygenase in the Rotated conformation
4rg4-assembly1_A 1.00 0.39 1.4e-08 sig 4rg4-assembly1_A Epsilon-caprolactone-bound crystal structure of cyclohexanone monooxygenase in the Loose conformation
8xg7-assembly1_A 1.00 0.38 9.8e-09 sig 8xg7-assembly1_A Crystal structure of phenylacetone monooxygenase mutant PM1 bound to FAD and NADP

Foldseek search of the AlphaFold DB model (mean pLDDT 71.8, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)Rv0942 (+ strand, 57 bp gap)
Downstream (3' on genome)Rv0944 (+ strand, 28 bp gap)

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: Rv0945 (oxidoreductase), medium confidence from genomic context alone (score 637 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0945 oxidoreductase 914 637 ctx neighborhood:590 textmining:774
Rv0944 fpg2 formamidopyrimidine-DNA glycosylase 924 620 ctx neighborhood:618 textmining:808
Rv3083 mymA FAD-containing monooxygenase MymA 608 608 ctx cooccurence:608
Rv0565c monooxygenase 582 582 ctx cooccurence:580
Rv1868 hyp hypothetical protein 564 564 ctx cooccurence:452
Rv3854c ethA monooxygenase EthA 558 558 ctx cooccurence:558
Rv1531 hyp hypothetical protein 524 524 ctx cooccurence:512
Rv2047c hyp hypothetical protein 496 496
Rv3097c lipY triacylglycerol lipase Lip 489 487 ctx cooccurence:443
Rv3638 transposase 474 474 coexpression:474
Rv1006 hyp hypothetical protein 452 452 ctx cooccurence:449
Rv1308 atpA exp ATP synthase subunit alpha 436 437 experimental:427
Rv1309 atpG ATP synthase subunit gamma 412 412
Rv3456c rplQ 50S ribosomal protein L17 409 410
Rv1507c hyp hypothetical protein 409 409

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: monooxygenase
  • MTBC0 PGAP product: hypothetical protein
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215458.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2072
  • Curated reference: UniProt P9WKN7 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 71.8)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 32 functional partner(s); context anchor Rv0945
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Predicted localisation: DeepTMHMM (Hallgren et al. 2022, doi:10.1101/2022.04.08.487609) for transmembrane topology and signal peptide
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001002|Rv0943c|
MAGVSEAERRGHRKLVRFQARRAIGPIRPTS