Rv0943c Still unknown · low auto-curated
H37Rv Rv0943c · MTBC0 mtbc0_001002 ·
31 aa · 1057167–1057259 (+) ·
RefSeq NP_215458.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | monooxygenase |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved hypothetical protein; no recognised domain. Function unknown. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WKN7
SwissProt · reviewed
· Predicted
|
|---|---|
| UniProt name | Uncharacterized protein Rv0943c |
UniProt still lists this protein as Uncharacterized protein Rv0943c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
P Inorganic ion transport and metabolism
|
|---|---|
| eggNOG description | Domain of unknown function (DUF4873) |
| Orthologous group | COG2072 |
| Gene Ontology (6) |
GO:0005575, GO:0005623, GO:0005886, GO:0016020, GO:0044464, GO:0071944
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.823 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 6 missense, 1 nonsense, 0 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.34% of strains (494) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0945 (oxidoreductase), medium confidence from genomic context alone (score 637 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0945 |
oxidoreductase | 914 | 637 ctx | neighborhood:590 textmining:774 |
Rv0944 fpg2 |
formamidopyrimidine-DNA glycosylase | 924 | 620 ctx | neighborhood:618 textmining:808 |
Rv3083 mymA |
FAD-containing monooxygenase MymA | 608 | 608 ctx | cooccurence:608 |
Rv0565c |
monooxygenase | 582 | 582 ctx | cooccurence:580 |
Rv1868 hyp |
hypothetical protein | 564 | 564 ctx | cooccurence:452 |
Rv3854c ethA |
monooxygenase EthA | 558 | 558 ctx | cooccurence:558 |
Rv1531 hyp |
hypothetical protein | 524 | 524 ctx | cooccurence:512 |
Rv2047c hyp |
hypothetical protein | 496 | 496 | |
Rv3097c lipY |
triacylglycerol lipase Lip | 489 | 487 ctx | cooccurence:443 |
Rv3638 |
transposase | 474 | 474 | coexpression:474 |
Rv1006 hyp |
hypothetical protein | 452 | 452 ctx | cooccurence:449 |
Rv1308 atpA |
ATP synthase subunit alpha | 436 | 437 | experimental:427 |
Rv1309 atpG |
ATP synthase subunit gamma | 412 | 412 | |
Rv3456c rplQ |
50S ribosomal protein L17 | 409 | 410 | |
Rv1507c hyp |
hypothetical protein | 409 | 409 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: monooxygenase
- MTBC0 PGAP product: hypothetical protein
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215458.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG2072 - Curated reference: UniProt P9WKN7 (SwissProt, reviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
32 functional partner(s); context anchor
Rv0945 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001002|Rv0943c| MAGVSEAERRGHRKLVRFQARRAIGPIRPTS