PE15 Family assigned · medium auto-curated
H37Rv Rv1386 · MTBC0 - ·
102 aa · 1561464–1561772 (+) ·
RefSeq YP_177805.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | PE family protein PE15 |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | PE family protein PE15. Pfam: PE (PF00934.26). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WIH1
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | PE family immunomodulator PE15 |
| Curated function | May play a pivotal role in the evasion of host immune response by M.tuberculosis. Mediates production of IL-10 via activation of the p38 and ERK1/2 mitogen-activated protein kinase (MAPK) signaling pathways. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | PE family |
| Orthologous group | 2B7DA |
| Gene Ontology (2) |
GO:0005575, GO:0005576
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | n/a |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 0 synonymous, 2 missense, 0 nonsense, 2 frameshift |
| Disruption | 2 distinct premature-stop/frameshift site(s); most common in 0.15% of strains (219) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
PE | PF00934.26 | 3.5e-20 | 3–91 | PE family |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: PPE20 (PPE family protein PPE20), high confidence from genomic context alone (score 818 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1387 PPE20 |
PPE family protein PPE20 | 961 | 818 ctx | neighborhood:818 textmining:795 |
Rv1385 pyrF |
orotidine 5'-phosphate decarboxylase | 477 | 477 ctx | neighborhood:477 |
Rv1382 hyp |
hypothetical protein | 464 | 465 ctx | neighborhood:465 |
Rv1384 carB |
carbamoyl-phosphate synthase large subunit | 464 | 465 ctx | neighborhood:465 |
Rv1379 pyrR |
bifunctional pyrimidine operon regulatory protein/uracil phosphoribosyltransferase | 464 | 465 ctx | neighborhood:465 |
Rv1383 carA |
carbamoyl-phosphate synthase small subunit | 464 | 465 ctx | neighborhood:465 |
Rv1380 pyrB |
aspartate carbamoyltransferase | 464 | 465 ctx | neighborhood:465 |
Rv1381 pyrC |
dihydroorotase | 464 | 465 ctx | neighborhood:465 |
Rv1388 mihF |
integration host factor MihF | 404 | 404 ctx | neighborhood:404 |
Rv0096 PPE1 |
PPE family protein PPE1 | 775 | 62 | textmining:771 |
Rv0286 PPE4 |
PPE family protein PPE4 | 706 | 46 | textmining:705 |
Rv2123 PPE37 |
PPE family protein PPE37 | 437 | 46 | textmining:434 |
Rv0256c PPE2 |
PPE family protein PPE2 | 851 | 41 | textmining:852 |
Rv2108 PPE36 |
PPE family protein PPE36 | 681 | 41 | textmining:682 |
Rv2219A |
membrane protein | 630 | 41 | textmining:630 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): PE family protein PE15
- Pfam (hmmscan --cut_ga): PE PF00934.26 (E=4e-20)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq YP_177805.1)
- Domains: Pfam-A via hmmscan --cut_ga — PE (PF00934.26)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2B7DA - Curated reference: UniProt P9WIH1 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
25 functional partner(s); context anchor
PPE20 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv1386|PE15 MTLRVVPESLAGASAAIEAVTARLAAAHAAAAPFIAAVIPPGSDSVSVCNAVEFSVHGSQHVAMAAQGVEELGRSGVGVAESGASYAARDALAAASYLSGGL