dfp Resolved · high auto-curated

H37Rv Rv1391 · MTBC0 mtbc0_001492 · 418 aa · 1574785–1576041 (+) · RefSeq NP_215907.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase
MTBC0 PGAP re-annotationbifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC
Revised (this work)Bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC. Pfam: Flavoprotein (PF02441.25), DFP (PF04127.23).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WNZ1 SwissProt · reviewed · Evidence at protein level
UniProt nameCoenzyme A biosynthesis bifunctional protein CoaBC
EC (curated) EC 4.1.1.36, EC 6.3.2.5
Curated functionCatalyzes two sequential steps in the biosynthesis of coenzyme A. In the first step cysteine is conjugated to 4'-phosphopantothenate to form 4-phosphopantothenoylcysteine. In the second step the latter compound is decarboxylated to form 4'-phosphopantotheine (By similarity). Required for growth and persistence in mice.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namecoaBC
eggNOG descriptionCatalyzes two steps in the biosynthesis of coenzyme A. In the first step cysteine is conjugated to 4'-phosphopantothenate to form 4-phosphopantothenoylcysteine, in the latter compound is decarboxylated to form 4'-phosphopantotheine
Orthologous groupCOG0452
EC number EC 4.1.1.36, EC 6.3.2.5
KEGG orthology K13038
KEGG pathways map00770, map01100
KEGG modules M00120
Gene Ontology (69) GO:0003674, GO:0003824, GO:0004633, GO:0005575, GO:0005623, GO:0005886, GO:0006139, GO:0006163, GO:0006164, GO:0006725, GO:0006732, GO:0006753 +57 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.301 · purifying
Polymorphic sites (≥ 0.1% of strains) 5 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
FlavoproteinPF02441.25 4.5e-289–173 Flavoprotein
DFPPF04127.23 1.6e-69191–411 DNA/pantothenate metabolism flavoprotein C-terminal domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: rpoZ (DNA-directed RNA polymerase subunit omega), high confidence from genomic context alone (score 894 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2965c kdtB phosphopantetheine adenylyltransferase 994 930 database:900 textmining:930
Rv3600c coaX type III pantothenate kinase 935 926 database:900
Rv1092c coaA pantothenate kinase 963 904 database:900 textmining:640
Rv1390 rpoZ DNA-directed RNA polymerase subunit omega 894 894 ctx neighborhood:863
Rv1389 gmk guanylate kinase 940 877 ctx neighborhood:783 textmining:538
Rv3602c panC pantothenate synthetase 927 866 database:800 textmining:480
Rv2334 cysK1 O-acetylserine sulfhydrylase 817 818 database:800
Rv3684 lyase 809 809 database:800
Rv0075 aminotransferase 806 807 database:800
Rv2294 cystathionine beta-lyase 804 805 database:800
Rv1392 metK S-adenosylmethionine synthetase 773 751 ctx neighborhood:593
Rv1388 mihF integration host factor MihF 746 747 ctx neighborhood:698
Rv1402 priA primosomal protein N' 716 717 coexpression:648
Rv2697c dut deoxyuridine 5'-triphosphate nucleotidohydrolase 716 699 coexpression:674
Rv3211 rhlE ATP-dependent RNA helicase RhlE 693 680 database:491

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase
  • MTBC0 PGAP product: bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC
  • Pfam (hmmscan --cut_ga): Flavoprotein PF02441.25 (E=4e-28), DFP PF04127.23 (E=2e-69)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215907.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Flavoprotein (PF02441.25), DFP (PF04127.23)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0452
  • Curated reference: UniProt P9WNZ1 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 63 functional partner(s); context anchor rpoZ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001492|Rv1391|dfp
MVDHKRIPKQVIVGVSGGIAAYKACTVVRQLTEASHRVRVIPTESALRFVGAATFEALSGEPVCTDVFADVPAVPHVHLGQQADLVVVAPATADLLARAAAGRADDLLTATLLTARCPVLFAPAMHTEMWLHPATVDNVATLRRRGAVVLEPATGRLTGADSGAGRLPEAEEITTLAQLLLERHDALPYDLAGRKLLVTAGGTREPIDPVRFIGNRSSGKQGYAVARVAAQRGADVTLIAGHTAGLVDPAGVEVVHVSSAQQLADAVSKHAPTADVLVMAAAVADFRPAQVATAKIKKGVEGPPTIELLRNDDVLAGVVRARAHGQLPNMRAIVGFAAETGDANGDVLFHARAKLRRKGCDLLVVNAVGEGRAFEVDSNDGWLLASDGTESALQHGSKTLMASRIVDAIVTFLAGCSS