Rv1291c Still unknown · low auto-curated
H37Rv Rv1291c · MTBC0 mtbc0_001382 ·
111 aa · 1454538–1454873 (-) ·
RefSeq NP_215807.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | DUF732 domain-containing protein |
| Revised (this work) | Conserved hypothetical protein; DUF domain(s) DUF732. Function unknown. Foldseek best (non-significant) hit: 3j9x-assembly1_A A Virus that Infects a Hyperthermophile Encapsidates (prob 0.47, TM 0.55). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
P9WM33
SwissProt · reviewed
· Predicted
|
|---|---|
| UniProt name | Uncharacterized protein Rv1291c |
UniProt still lists this protein as Uncharacterized protein Rv1291c; the revised annotation above is ahead of the current UniProt record.
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | Protein of unknown function (DUF732) |
| Orthologous group | 2BN0A |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.116 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 3 synonymous, 1 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
DUF732 | PF05305.20 | 9.6e-19 | 37–106 | Protein of unknown function (DUF732) |
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 69.7 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
3j9x-assembly1_A |
0.47 | 0.55 | 1.0e+00 | 3j9x-assembly1_A A Virus that Infects a Hyperthermophile Encapsidates A-Form DNA |
5w7g-assembly1_B |
0.41 | 0.51 | 1.2e+00 | 5w7g-assembly1_B An envelope of a filamentous hyperthermophilic virus carries lipids in a horseshoe conformation |
6wq0-assembly1_A |
0.21 | 0.54 | 2.8e+00 | 6wq0-assembly1_A Cryo-EM of the S. solfataricus rod-shaped virus, SSRV1 |
3f2e-assembly1_A |
0.15 | 0.44 | 3.0e+00 | 3f2e-assembly1_A Crystal structure of Yellowstone SIRV coat protein C-terminus |
2ezk-assembly1_A |
0.15 | 0.53 | 4.1e+00 | 2ezk-assembly1_A SOLUTION NMR STRUCTURE OF THE IBETA SUBDOMAIN OF THE MU END DNA BINDING DOMAIN OF PHAGE MU TRANSPOSASE, REGULARIZED MEAN STRUCTURE |
4fcy-assembly1_B |
0.10 | 0.40 | 3.9e+00 | 4fcy-assembly1_B Crystal structure of the bacteriophage Mu transpososome |
4fcy-assembly1_A |
0.09 | 0.40 | 4.5e+00 | 4fcy-assembly1_A Crystal structure of the bacteriophage Mu transpososome |
4gk5-assembly2_F-3 |
0.08 | 0.41 | 7.0e+00 | 4gk5-assembly2_F-3 Crystal structure of human Rev3-Rev7-Rev1-Polkappa complex |
Functional interaction network (STRING v12, guilt-by-association)
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1157c hyp |
hypothetical protein | 657 | 41 | textmining:657 |
Rv3207c hyp |
hypothetical protein | 653 | 41 | textmining:653 |
Rv3742c |
oxidoreductase | 628 | 41 | textmining:628 |
Rv2223c caeB |
carboxylesterase B | 549 | 41 | textmining:549 |
Rv3296 lhr |
ATP-dependent helicase | 546 | 41 | textmining:546 |
Rv1158c hyp |
hypothetical protein | 543 | 41 | textmining:543 |
Rv0309 hyp |
hypothetical protein | 518 | 41 | textmining:518 |
Rv2249c glpD1 |
glycerol-3-phosphate dehydrogenase | 517 | 41 | textmining:517 |
Rv3201c adnB |
ATP-dependent DNA helicase | 511 | 41 | textmining:511 |
Rv1242 vapC33 |
ribonuclease VapC33 | 505 | 41 | textmining:505 |
Rv3106 fprA |
NADPH-ferredoxin reductase FprA | 434 | 41 | textmining:434 |
Rv2190c ripC |
endopeptidase | 434 | 41 | textmining:434 |
Rv2989 |
transcriptional regulator | 431 | 41 | textmining:431 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: hypothetical protein
- MTBC0 PGAP product: DUF732 domain-containing protein
- Pfam (hmmscan --cut_ga): DUF732 PF05305.20 (E=1e-18)
- Foldseek best: 3j9x-assembly1_A A Virus that Infects a Hyperthermophile Encapsidates A-Form DNA (prob 0.47, E=1e+00, TM=0.55)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215807.1)
- Domains: Pfam-A via hmmscan --cut_ga — DUF732 (PF05305.20)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2BN0A - Curated reference: UniProt P9WM33 (SwissProt, reviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 69.7, low)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s)
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001382|Rv1291c| MFTRRFAASMVGTTLTAATLGLAALGFAGTASASSTDEAFLAQLQADGITPPSAARAIKDAHAVCDALDEGHSAKAVIKAVAKATGLSAKGAKTFAVDAASAYCPQYVTSS