Rv1291c Still unknown · low auto-curated

H37Rv Rv1291c · MTBC0 mtbc0_001382 · 111 aa · 1454538–1454873 (-) · RefSeq NP_215807.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF732 domain-containing protein
Revised (this work)Conserved hypothetical protein; DUF domain(s) DUF732. Function unknown. Foldseek best (non-significant) hit: 3j9x-assembly1_A A Virus that Infects a Hyperthermophile Encapsidates (prob 0.47, TM 0.55).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WM33 SwissProt · reviewed · Predicted
UniProt nameUncharacterized protein Rv1291c

UniProt still lists this protein as Uncharacterized protein Rv1291c; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF732)
Orthologous group2BN0A

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.116 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF732PF05305.20 9.6e-1937–106 Protein of unknown function (DUF732)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 69.7 (low). Low-confidence model: the fold may be unreliable, so treat these structural hits with caution.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
3j9x-assembly1_A 0.47 0.55 1.0e+00 3j9x-assembly1_A A Virus that Infects a Hyperthermophile Encapsidates A-Form DNA
5w7g-assembly1_B 0.41 0.51 1.2e+00 5w7g-assembly1_B An envelope of a filamentous hyperthermophilic virus carries lipids in a horseshoe conformation
6wq0-assembly1_A 0.21 0.54 2.8e+00 6wq0-assembly1_A Cryo-EM of the S. solfataricus rod-shaped virus, SSRV1
3f2e-assembly1_A 0.15 0.44 3.0e+00 3f2e-assembly1_A Crystal structure of Yellowstone SIRV coat protein C-terminus
2ezk-assembly1_A 0.15 0.53 4.1e+00 2ezk-assembly1_A SOLUTION NMR STRUCTURE OF THE IBETA SUBDOMAIN OF THE MU END DNA BINDING DOMAIN OF PHAGE MU TRANSPOSASE, REGULARIZED MEAN STRUCTURE
4fcy-assembly1_B 0.10 0.40 3.9e+00 4fcy-assembly1_B Crystal structure of the bacteriophage Mu transpososome
4fcy-assembly1_A 0.09 0.40 4.5e+00 4fcy-assembly1_A Crystal structure of the bacteriophage Mu transpososome
4gk5-assembly2_F-3 0.08 0.41 7.0e+00 4gk5-assembly2_F-3 Crystal structure of human Rev3-Rev7-Rev1-Polkappa complex

Functional interaction network (STRING v12, guilt-by-association)

PartnerProductScoreNo text-miningChannels (≥400)
Rv1157c hyp hypothetical protein 657 41 textmining:657
Rv3207c hyp hypothetical protein 653 41 textmining:653
Rv3742c oxidoreductase 628 41 textmining:628
Rv2223c caeB carboxylesterase B 549 41 textmining:549
Rv3296 lhr ATP-dependent helicase 546 41 textmining:546
Rv1158c hyp hypothetical protein 543 41 textmining:543
Rv0309 hyp hypothetical protein 518 41 textmining:518
Rv2249c glpD1 glycerol-3-phosphate dehydrogenase 517 41 textmining:517
Rv3201c adnB ATP-dependent DNA helicase 511 41 textmining:511
Rv1242 vapC33 ribonuclease VapC33 505 41 textmining:505
Rv3106 fprA NADPH-ferredoxin reductase FprA 434 41 textmining:434
Rv2190c ripC endopeptidase 434 41 textmining:434
Rv2989 transcriptional regulator 431 41 textmining:431

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: DUF732 domain-containing protein
  • Pfam (hmmscan --cut_ga): DUF732 PF05305.20 (E=1e-18)
  • Foldseek best: 3j9x-assembly1_A A Virus that Infects a Hyperthermophile Encapsidates A-Form DNA (prob 0.47, E=1e+00, TM=0.55)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215807.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF732 (PF05305.20)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2BN0A
  • Curated reference: UniProt P9WM33 (SwissProt, reviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 69.7, low)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 13 functional partner(s)
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001382|Rv1291c|
MFTRRFAASMVGTTLTAATLGLAALGFAGTASASSTDEAFLAQLQADGITPPSAARAIKDAHAVCDALDEGHSAKAVIKAVAKATGLSAKGAKTFAVDAASAYCPQYVTSS