thrC Resolved · high auto-curated

H37Rv Rv1295 · MTBC0 mtbc0_001387 · 360 aa · 1459736–1460818 (+) · RefSeq NP_215811.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)threonine synthase
MTBC0 PGAP re-annotationthreonine synthase
Revised (this work)Threonine synthase. Pfam: PALP (PF00291.32).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WG59 SwissProt · reviewed · Evidence at protein level
UniProt nameThreonine synthase
EC (curated) EC 4.2.3.1
Curated functionCatalyzes the gamma-elimination of phosphate from L-phosphohomoserine and the beta-addition of water to produce L-threonine.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category E Amino acid transport and metabolism
Preferred namethrC
eggNOG descriptionCatalyzes the gamma-elimination of phosphate from L- phosphohomoserine and the beta-addition of water to produce L- threonine
Orthologous groupCOG0498
EC number EC 4.2.3.1
KEGG orthology K01733
KEGG pathways map00260, map00750, map01100, map01110, map01120, map01230
KEGG modules M00018
Gene Ontology (57) GO:0003674, GO:0003824, GO:0004795, GO:0005488, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0005886, GO:0006082, GO:0006520 +45 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.437 · purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 5 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PALPPF00291.32 2.2e-7232–327 Pyridoxal-phosphate dependent enzyme

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: thrB (homoserine kinase), high confidence from genomic context alone (score 998 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1296 thrB homoserine kinase 999 998 ctx neighborhood:731 coexpression:920 database:900 textmining:709
Rv1294 thrA homoserine dehydrogenase 999 996 ctx neighborhood:881 coexpression:958 textmining:794
Rv1559 ilvA threonine dehydratase IlvA 967 953 coexpression:525 database:900
Rv0884c serC phosphoserine aminotransferase 951 943 database:900
Rv1292 argS arginine--tRNA ligase 906 903 ctx neighborhood:882
Rv1293 lysA diaminopimelate decarboxylase 915 889 ctx neighborhood:882
Rv3709c ask aspartokinase 830 779 coexpression:725
Rv2987c leuD 3-isopropylmalate dehydratase small subunit 800 739 coexpression:718
Rv3001c ilvC ketol-acid reductoisomerase 795 712 coexpression:636
Rv2606c snzP pyridoxine biosynthesis protein 724 661 coexpression:655
Rv0069c sdaA L-serine dehydratase 636 600 database:500
Rv2996c serA1 D-3-phosphoglycerate dehydrogenase 627 583 coexpression:477
Rv0189c ilvD dihydroxy-acid dehydratase 675 567 coexpression:413
Rv3002c ilvN acetolactate synthase small subunit 667 565 coexpression:529
Rv0728c serA2 D-3-phosphoglycerate dehydrogenase SerA 606 561 coexpression:474

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: threonine synthase
  • MTBC0 PGAP product: threonine synthase
  • Pfam (hmmscan --cut_ga): PALP PF00291.32 (E=2e-72)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215811.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PALP (PF00291.32)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0498
  • Curated reference: UniProt P9WG59 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 59 functional partner(s); context anchor thrB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001387|Rv1295|thrC
MTVPPTATHQPWPGVIAAYRDRLPVGDDWTPVTLLEGGTPLIAATNLSKQTGCTIHLKVEGLNPTGSFKDRGMTMAVTDALAHGQRAVLCASTGNTSASAAAYAARAGITCAVLIPQGKIAMGKLAQAVMHGAKIIQIDGNFDDCLELARKMAADFPTISLVNSVNPVRIEGQKTAAFEIVDVLGTAPDVHALPVGNAGNITAYWKGYTEYHQLGLIDKLPRMLGTQAAGAAPLVLGEPVSHPETIATAIRIGSPASWTSAVEAQQQSKGRFLAASDEEILAAYHLVARVEGVFVEPASAASIAGLLKAIDDGWVARGSTVVCTVTGNGLKDPDTALKDMPSVSPVPVDPVAVVEKLGLA