hemK Resolved · high auto-curated

H37Rv Rv1300 · MTBC0 mtbc0_001392 · 325 aa · 1465604–1466581 (+) · RefSeq NP_215816.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)release factor glutamine methyltransferase
MTBC0 PGAP re-annotationpeptide chain release factor N(5)-glutamine methyltransferase
Revised (this work)Peptide chain release factor N(5)-glutamine methyltransferase. Pfam: PrmC_N (PF17827.7), MTS (PF05175.21), Methyltransf_25 (PF13649.13), Methyltransf_31 (PF13847.13), Methyltransf_11 (PF08241.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WHV3 SwissProt · reviewed · Evidence at protein level
UniProt nameRelease factor glutamine methyltransferase
EC (curated) EC 2.1.1.297
Curated functionMethylates the class 1 translation termination release factors RF1/PrfA and RF2/PrfB on the glutamine residue of the universally conserved GGQ motif.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred nameprmC
eggNOG descriptionMethylates the class 1 translation termination release factors RF1 PrfA and RF2 PrfB on the glutamine residue of the universally conserved GGQ motif
Orthologous groupCOG2890
EC number EC 2.1.1.297
KEGG orthology K02493
Gene Ontology (18) GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0005829, GO:0008150, GO:0008152, GO:0008168, GO:0008757, GO:0016740 +6 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.362 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PrmC_NPF17827.7 1.5e-1226–94 PrmC N-terminal domain
MTSPF05175.21 9.6e-06133–216 Methyltransferase small domain
Methyltransf_25PF13649.13 5.8e-08134–209 Methyltransferase domain
Methyltransf_31PF13847.13 3.9e-07134–265 Methyltransferase domain
Methyltransf_11PF08241.19 2.1e-04136–209 Methyltransferase domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: prfA (peptide chain release factor PrfA), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1299 prfA peptide chain release factor PrfA 999 999 ctx neighborhood:881 coexpression:896 experimental:890 textmining:551
Rv1301 threonylcarbamoyl-AMP synthase 982 980 ctx neighborhood:863 fusion:758 coexpression:440
Rv1307 atpH ATP synthase subunit b/delta 878 879 ctx neighborhood:641 coexpression:409 experimental:474
Rv2629 hyp hypothetical protein 889 872 database:844
Rv1305 atpE ATP synthase subunit C 856 857 ctx neighborhood:651 experimental:474
Rv1298 rpmE 50S ribosomal protein L31 812 789 ctx neighborhood:778
Rv1302 rfe decaprenyl-phosphate N-acetylglucosaminephosphotransferase 777 777 ctx neighborhood:770
Rv1304 atpB ATP synthase subunit A 734 734 ctx neighborhood:670
Rv1308 atpA ATP synthase subunit alpha 714 714 ctx neighborhood:428 experimental:474
Rv1309 atpG ATP synthase subunit gamma 693 692 ctx neighborhood:411 experimental:446
Rv1311 atpC ATP synthase subunit epsilon 692 692 ctx neighborhood:420 experimental:474
Rv1310 atpD ATP synthase subunit beta 682 682 ctx neighborhood:400 experimental:474
Rv1303 hyp hypothetical protein 672 672 ctx neighborhood:670
Rv1297 rho transcription termination factor Rho 639 639 ctx neighborhood:625
Rv1507c hyp hypothetical protein 521 521 experimental:446

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: release factor glutamine methyltransferase
  • MTBC0 PGAP product: peptide chain release factor N(5)-glutamine methyltransferase
  • Pfam (hmmscan --cut_ga): PrmC_N PF17827.7 (E=2e-12), MTS PF05175.21 (E=1e-05), Methyltransf_25 PF13649.13 (E=6e-08), Methyltransf_31 PF13847.13 (E=4e-07), Methyltransf_11 PF08241.19 (E=2e-04)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215816.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PrmC_N (PF17827.7), MTS (PF05175.21), Methyltransf_25 (PF13649.13), Methyltransf_31 (PF13847.13), Methyltransf_11 (PF08241.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG2890
  • Curated reference: UniProt P9WHV3 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 44 functional partner(s); context anchor prfA
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001392|Rv1300|hemK
MTSAPATMRWGNLPLAGESGTMTLRQAIDLAAALLAEAGVDSARCDAEQLAAHLAGTDRGRLPLFEPPGDEFFGRYRDIVTARARRVPLQHLIGTVSFGPVVLHVGPGVFVPRPETEAILAWATAQSLPARPLIVDACTGSGALAVALAQHRANLGLKARIIGIDDSDCALDYARRNAAGTPVELVRADVTTPCLLPELDGQVDLMVSNPPYIPDAAVLEPEVAQHDPHHALFGGPDGMTVISAVVGLAGRWLRPGGLFAVEHDDTTSSSTVDLVSSTKLFVDVQARKDLAGRPRFVTAMRWGHLPLAGENGAIDPRQRRCRAKR