Rv1066 Family assigned · medium auto-curated

H37Rv Rv1066 · MTBC0 mtbc0_001146 · 131 aa · 1195337–1195732 (+) · RefSeq NP_215582.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationrhodanese-like domain-containing protein
Revised (this work)Rhodanese-like domain-containing protein. Pfam: Rhodanese (PF00581.26).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53414 TrEMBL · unreviewed · Evidence at protein level
UniProt nameRhodanese domain-containing protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category P Inorganic ion transport and metabolism
eggNOG descriptionsulfurtransferase
Orthologous groupCOG0607

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RhodanesePF00581.26 4.0e-0823–116 Rhodanese-like domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: lpqV (lipoprotein LpqV), medium confidence from genomic context alone (score 600 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1065 hyp hypothetical protein 996 996 ctx neighborhood:836 fusion:615 cooccurence:631 coexpression:860
Rv3846 sodA superoxide dismutase 634 612 experimental:573
Rv1064c lpqV lipoprotein LpqV 600 600 ctx neighborhood:597
Rv2367c ybeY endoribonuclease 583 584 experimental:573
Rv3456c rplQ 50S ribosomal protein L17 517 517 experimental:466
Rv3268 hyp hypothetical protein 514 514
Rv3443c rplM 50S ribosomal protein L13 509 509 experimental:453
Rv0710 rpsQ 30S ribosomal protein S17 508 509 experimental:476
Rv2442c rplU 50S ribosomal protein L21 497 498 experimental:466
Rv0701 rplC 50S ribosomal protein L3 491 492 experimental:450
Rv0640 rplK 50S ribosomal protein L11 491 492 experimental:461
Rv0715 rplX 50S ribosomal protein L24 483 484 experimental:453
Rv0723 rplO 50S ribosomal protein L15 481 482 experimental:453
Rv1063c NTE family protein 474 474 ctx neighborhood:472
Rv2643 arsC arsenic-transport integral membrane protein ArsC 468 445

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: rhodanese-like domain-containing protein
  • Pfam (hmmscan --cut_ga): Rhodanese PF00581.26 (E=4e-08)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215582.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rhodanese (PF00581.26)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0607
  • Curated reference: UniProt O53414 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 43 functional partner(s); context anchor lpqV
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001146|Rv1066|
MSRIDRVLEAARRRYRRLAADQVPEAARRGAVLVDIRPQAQRAREGEVPGALVIERNVLEWRCDPTSDARLPQAVDDDVEWVILCSEGYTSSLAAASLLDLGLHRATDVVGGYRALAAGGVLAELGGAVGG