lpqV Resolved · high auto-curated

H37Rv Rv1064c · MTBC0 mtbc0_001144 · 139 aa · 1194243–1194662 (-) · RefSeq NP_215580.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)lipoprotein LpqV
MTBC0 PGAP re-annotationlipoprotein LpqV
Revised (this work)Lipoprotein LpqV. Pfam: LpqV (PF17301.8).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WK57 SwissProt · reviewed · Inferred from homology
UniProt namePutative lipoprotein LpqV

UniProt still lists this protein as Putative lipoprotein LpqV; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namelpqV
eggNOG descriptionPutative lipoprotein LpqV
Orthologous group2AWM4

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 4 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.21% of strains (301) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
LpqVPF17301.8 2.5e-5131–139 Putative lipoprotein LpqV

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv1063c (NTE family protein), high confidence from genomic context alone (score 787 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1063c NTE family protein 786 787 ctx neighborhood:786
Rv1066 hyp hypothetical protein 600 600 ctx neighborhood:597
Rv1065 hyp hypothetical protein 572 572 ctx neighborhood:568

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: lipoprotein LpqV
  • MTBC0 PGAP product: lipoprotein LpqV
  • Pfam (hmmscan --cut_ga): LpqV PF17301.8 (E=3e-51)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215580.1)
  • Domains: Pfam-A via hmmscan --cut_ga — LpqV (PF17301.8)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2AWM4
  • Curated reference: UniProt P9WK57 (SwissProt, reviewed; Inferred from homology)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 3 functional partner(s); context anchor Rv1063c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001144|Rv1064c|lpqV
MRPSRYAPLLCAMVLALAWLSAVAGCSRGGSSKAGRSSSVAGTLPAGVVGVSPAGVTTRVDAPAESTEEEYYQACHAARLWMDAQPGSGESLIEPYLAVVQASPSGVAGSWHIRWAALTPARQAAVIVAARAAANAECG