Rv1072 Family assigned · medium auto-curated

H37Rv Rv1072 · MTBC0 mtbc0_001152 · 278 aa · 1204548–1205384 (+) · RefSeq NP_215588.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)transmembrane protein
MTBC0 PGAP re-annotationBax inhibitor-1/YccA family protein
Revised (this work)Bax inhibitor-1/YccA family protein. Pfam: BaxI_1 (PF12811.13), Bax1-I (PF01027.27).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53420 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable conserved transmembrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionmembrane
Orthologous groupCOG4760

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.182 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 4 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
BaxI_1PF12811.13 6.3e-8523–277 Bax inhibitor 1 like
Bax1-IPF01027.27 4.0e-1457–274 Inhibitor of apoptosis-promoting Bax1

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: echA9 (enoyl-CoA hydratase EchA9), medium confidence from genomic context alone (score 522 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv1073 hyp hypothetical protein 596 596 ctx neighborhood:578
Rv2710 sigB RNA polymerase sigma factor SigB 584 585 coexpression:585
Rv1071c echA9 enoyl-CoA hydratase EchA9 522 522 ctx neighborhood:519
Rv1070c echA8 enoyl-CoA hydratase EchA8 514 515 ctx neighborhood:509
Rv1069c hyp hypothetical protein 501 501 ctx neighborhood:498
Rv1234 transmembrane protein 500 500 coexpression:416
Rv3470c ilvB2 acetolactate synthase large subunit 440 441 coexpression:441
Rv3846 sodA superoxide dismutase 423 401 coexpression:401

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: transmembrane protein
  • MTBC0 PGAP product: Bax inhibitor-1/YccA family protein
  • Pfam (hmmscan --cut_ga): BaxI_1 PF12811.13 (E=6e-85), Bax1-I PF01027.27 (E=4e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215588.1)
  • Domains: Pfam-A via hmmscan --cut_ga — BaxI_1 (PF12811.13), Bax1-I (PF01027.27)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG4760
  • Curated reference: UniProt O53420 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 8 functional partner(s); context anchor echA9
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001152|Rv1072|
MRETSNPVFRSLPKQRGGYAQFGTGTAQQGFPADPYLAPYREAKATRPLTIDDVVTKTGLTLAMLAGTAVVSYFLVASNVALAMPLTLVGALGGLALVLVATFGRKQDNPAIVLSYAALEGLFLGAISFVLANFTVASANAGVLIGEAILGTMGVFFGMLVVYKTGAIRVTPKFTRMVVAALFGVLVLMLGNLVLAMFNVGGGEGLGLRSPGPLGIIFSLVCIGIAAFSFLIDFDAADQMIRAGAPEKAAWGVALGLTVTLVWLYIEILRLLSYLQNE