Rv1072 Family assigned · medium auto-curated
H37Rv Rv1072 · MTBC0 mtbc0_001152 ·
278 aa · 1204548–1205384 (+) ·
RefSeq NP_215588.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | transmembrane protein |
|---|---|
| MTBC0 PGAP re-annotation | Bax inhibitor-1/YccA family protein |
| Revised (this work) | Bax inhibitor-1/YccA family protein. Pfam: BaxI_1 (PF12811.13), Bax1-I (PF01027.27). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Curated reference (UniProt)
| UniProt |
O53420
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable conserved transmembrane protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
S Function unknown
|
|---|---|
| eggNOG description | membrane |
| Orthologous group | COG4760 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.182 · strong purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 2 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
BaxI_1 | PF12811.13 | 6.3e-85 | 23–277 | Bax inhibitor 1 like |
Bax1-I | PF01027.27 | 4.0e-14 | 57–274 | Inhibitor of apoptosis-promoting Bax1 |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: echA9 (enoyl-CoA hydratase EchA9), medium confidence from genomic context alone (score 522 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv1073 hyp |
hypothetical protein | 596 | 596 ctx | neighborhood:578 |
Rv2710 sigB |
RNA polymerase sigma factor SigB | 584 | 585 | coexpression:585 |
Rv1071c echA9 |
enoyl-CoA hydratase EchA9 | 522 | 522 ctx | neighborhood:519 |
Rv1070c echA8 |
enoyl-CoA hydratase EchA8 | 514 | 515 ctx | neighborhood:509 |
Rv1069c hyp |
hypothetical protein | 501 | 501 ctx | neighborhood:498 |
Rv1234 |
transmembrane protein | 500 | 500 | coexpression:416 |
Rv3470c ilvB2 |
acetolactate synthase large subunit | 440 | 441 | coexpression:441 |
Rv3846 sodA |
superoxide dismutase | 423 | 401 | coexpression:401 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Legacy H37Rv annotation: transmembrane protein
- MTBC0 PGAP product: Bax inhibitor-1/YccA family protein
- Pfam (hmmscan --cut_ga): BaxI_1 PF12811.13 (E=6e-85), Bax1-I PF01027.27 (E=4e-14)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215588.1)
- Domains: Pfam-A via hmmscan --cut_ga — BaxI_1 (PF12811.13), Bax1-I (PF01027.27)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG4760 - Curated reference: UniProt O53420 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
8 functional partner(s); context anchor
echA9 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_001152|Rv1072| MRETSNPVFRSLPKQRGGYAQFGTGTAQQGFPADPYLAPYREAKATRPLTIDDVVTKTGLTLAMLAGTAVVSYFLVASNVALAMPLTLVGALGGLALVLVATFGRKQDNPAIVLSYAALEGLFLGAISFVLANFTVASANAGVLIGEAILGTMGVFFGMLVVYKTGAIRVTPKFTRMVVAALFGVLVLMLGNLVLAMFNVGGGEGLGLRSPGPLGIIFSLVCIGIAAFSFLIDFDAADQMIRAGAPEKAAWGVALGLTVTLVWLYIEILRLLSYLQNE