Rv1060 Family assigned · medium auto-curated

H37Rv Rv1060 · MTBC0 mtbc0_001140 · 157 aa · 1190847–1191320 (+) · RefSeq NP_215576.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationSRPBCC family protein
Revised (this work)SRPBCC family protein. Pfam: Polyketide_cyc2 (PF10604.16).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O53408 TrEMBL · unreviewed · Evidence at protein level
UniProt nameSRPBCC family protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionPolyketide cyclase / dehydrase and lipid transport
Orthologous group2FAVW

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.471 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Polyketide_cyc2PF10604.16 5.7e-177–155 Polyketide cyclase / dehydrase and lipid transport

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: fadD14 (fatty-acid--CoA ligase FadD14), high confidence from genomic context alone (score 774 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1061 hyp hypothetical protein 853 853 ctx neighborhood:832
Rv1062 hyp hypothetical protein 831 832 ctx neighborhood:832
Rv1059 hyp hypothetical protein 809 809 ctx neighborhood:808
Rv1058 fadD14 fatty-acid--CoA ligase FadD14 775 774 ctx neighborhood:738
Rv2487c PE_PGRS42 PE-PGRS family protein PE_PGRS42 718 718 ctx cooccurence:718
Rv3899c hyp hypothetical protein 686 686 ctx cooccurence:686
Rv2098c PE_PGRS36 PE-PGRS family protein PE_PGRS36; Rv2098c, (MTCY49.38c), len: 434 aa. PE_PGRS36,Member of the Mycobacterium tuberculosis PE family, PGRS sub 685 686 ctx cooccurence:684
Rv1057 hyp hypothetical protein 575 576 ctx neighborhood:404
Rv3768 hyp hypothetical protein 560 560 ctx cooccurence:560
Rv0048c membrane protein 548 549 ctx cooccurence:546
Rv0977 PE_PGRS16 PE-PGRS family protein PE_PGRS16 540 540 ctx cooccurence:540
Rv3435c transmembrane protein 534 535 ctx cooccurence:532
Rv3894c eccC2 ESX-2 type VII secretion system protein EccC 525 525 ctx cooccurence:525
Rv2423 hyp hypothetical protein 524 524 ctx cooccurence:522
Rv2248 hyp hypothetical protein 512 512 ctx cooccurence:512

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: SRPBCC family protein
  • Pfam (hmmscan --cut_ga): Polyketide_cyc2 PF10604.16 (E=6e-17)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215576.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Polyketide_cyc2 (PF10604.16)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2FAVW
  • Curated reference: UniProt O53408 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 23 functional partner(s); context anchor fadD14
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001140|Rv1060|
MAKSVVVEQSRAIPVQSEDAFGGTLAAALPVICSHWYGLIPPIKEVRDQTGAWDSVGQARVITMVGGGRVREELTSVDPPRSFGYTLTDIKGPLAPLVALVEGKWSFAPADTGTTVTWQWTIHPRSALAAPVLPVFARMWRGYARGVLEKLSALLVG