Rv3143 Resolved · medium auto-curated

H37Rv Rv3143 · MTBC0 mtbc0_003341 · 133 aa · 3532356–3532757 (+) · RefSeq NP_217659.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)response regulator
MTBC0 PGAP re-annotationresponse regulator
Revised (this work)Response regulator.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WGL7 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized response regulatory protein Rv3143

UniProt still lists this protein as Uncharacterized response regulatory protein Rv3143; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
eggNOG descriptionresponse regulator
Orthologous groupCOG0784
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: nuoJ (NADH-quinone oxidoreductase subunit J), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3154 nuoJ NADH-quinone oxidoreductase subunit J 999 999 ctx cooccurence:695 experimental:997
Rv3151 nuoG NADH-quinone oxidoreductase subunit G 999 999 ctx cooccurence:740 experimental:997
Rv3147 nuoC NADH-quinone oxidoreductase subunit C 999 999 ctx cooccurence:705 experimental:997
Rv3153 nuoI NADH-quinone oxidoreductase subunit I 998 999 ctx cooccurence:516 experimental:997
Rv3146 nuoB NADH-quinone oxidoreductase subunit B 998 998 ctx neighborhood:473 experimental:997
Rv3145 nuoA NADH-quinone oxidoreductase subunit A 998 998 ctx neighborhood:477 experimental:997
Rv3149 nuoE NADH-quinone oxidoreductase subunit E 950 949 ctx cooccurence:524 experimental:870
Rv3148 nuoD NADH-quinone oxidoreductase subunit D 959 926 experimental:870 textmining:478
Rv3150 nuoF NADH-quinone oxidoreductase subunit F 922 920 experimental:870
Rv3158 nuoN NADH-quinone oxidoreductase subunit N 916 913 experimental:870
Rv3156 nuoL NADH-quinone oxidoreductase subunit L 914 911 experimental:870
Rv3157 nuoM NADH-quinone oxidoreductase subunit M 897 897 experimental:870
Rv3155 nuoK NADH-quinone oxidoreductase subunit K 901 896 experimental:870
Rv3152 nuoH NADH-quinone oxidoreductase subunit H 896 896 experimental:870
Rv3692 moxR2 methanol dehydrogenase transcriptional regulator MoxR 798 798 coexpression:798

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: response regulator
  • MTBC0 PGAP product: response regulator
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217659.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0784
  • Curated reference: UniProt P9WGL7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 64 functional partner(s); context anchor nuoJ
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003341|Rv3143|
MPDSSTALRILVYSDNVQTRERVMRALGKRLHPDLPDLTYVEVATGPMVIRQMDRGGIDLAILDGEATPTGGMGIAKQLKDELASCPPILVLTGRPDDTWLASWSRAEAAVPHPVDPIVLGRTVLSLLRAPAH