Rv3143 Resolved · medium auto-curated

H37Rv Rv3143 · MTBC0 mtbc0_003341 · 133 aa · 3532356–3532757 MTBC0 (+) · RefSeq NP_217659.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)response regulator
MTBC0 PGAP re-annotationresponse regulator
Revised (this work)Response regulator.
Functional category (TubercuList)regulatory proteins

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 6 publications

6 TB publications mention this gene. 6 publication(s) discuss this gene (6 in a M. tuberculosis context, 3 in other mycobacteria — M. smegmatis (3)).

Most recent 5 of 6.
PublicationDate
Functional analysis of two component signaling system in Mycobacterium tuberculosis. doi:10.1016/j.gene.2025.149868 2026
Structure of mycobacterial respiratory complex I. doi:10.1073/pnas.2214949120 2023
The Orphan Response Regulator Rv3143 Modulates the Activity of the NADH Dehydrogenase Complex (Nuo) in Mycobacterium tuberculosis via Protein-Protein Interactions. doi:10.3389/fcimb.2022.909507 2022
Orphan response regulator Rv3143 increases antibiotic sensitivity by regulating cell wall permeability in Mycobacterium smegmatis. doi:10.1016/j.abb.2020.108522 2020
Transcriptional and proteomic analyses of two-component response regulators in multidrug-resistant Mycobacterium tuberculosis. doi:10.1016/j.ijantimicag.2015.02.018 2015

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Conditional expression context (iModulons)

Member of 2 independently-modulated gene set(s): PyrR (pyrR), Unc_9.

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

Post-translational modifications

1 reported modified residue(s): 4-aspartylphosphate @64.

Experimentally reported post-translational modification(s). A phosphosite indicates the protein is expressed and is a substrate of the M. tuberculosis Ser/Thr/Tyr kinase signalling network — a regulatory context, NOT a molecular function. Source: UniProt (Modified residue features; PTM sites curated from the M. tuberculosis literature).

CRISPRi vulnerability

Vulnerability index 0.08 (95% CI -0.85 to 1.27). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionUnknown, but could be involved in regulatory mechanism

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb3167 · 99.2% identity
M. marinum MMAR_1486 · 87.9% identity
M. smegmatis MSMEG_2064 · 74.2% identity
M. orygis RJtmp_003238 · 99.2% identity
M. abscessus MAB_2133 · 59.2% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WGL7 SwissProt · reviewed · Evidence at protein level
UniProt nameUncharacterized response regulatory protein Rv3143

UniProt still lists this protein as Uncharacterized response regulatory protein Rv3143; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category T Signal transduction mechanisms
eggNOG descriptionresponse regulator
Orthologous groupCOG0784
Gene Ontology (6) GO:0005575, GO:0005618, GO:0005623, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.0 · strong purifying
Polymorphic sites (≥ 0.1% of strains) 1 synonymous, 0 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Actinomycetia

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 1 consensus substitution(s)
low power (1 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 51/53 (96%) · mean identity 84.4% · 4/4 closest MTBAP relatives
conserved across the genus (present in 51/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 7/13 non-Mycobacterium reference genomes (down to Actinomycetia) · mean identity 60.6%
detected across the class Actinomycetia (beyond Corynebacteriales) but not outside the phylum — an Actinobacteria-level ancient gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 5 in the ORF — 0 in the essential state, 0 growth-defect, 5 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 106.2. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.
CaveatRead with some caution: only 5 TA (Himar1) sites in the whole ORF (atlas median 13). The DeJesus 2017 call rests on fewer independent observations than for a longer gene. If this gene overlaps a neighbour (see Genomic-neighbour overlap section below), some of these 5 sites may fall inside the neighbour's ORF rather than its own, leaving even fewer truly informative sites than the raw count suggests. (P20.3)

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Proteomics (mass spectrometry) detected

MS detectiondetected in 15 of 16 independent MS datasets
Integrated abundance426.0 ppm · rank 472/3519 (86.6th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length133 aa
Molecular weight14.4 kDa
Theoretical pI5.86
GRAVY-0.02 (hydrophilic)
Aliphatic index104.1
Aromaticity0.03
Instability index32.0 (stable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 88.9

PDB hitprobTM-scoreE-valueDescription
8e9g-assembly1_O 1.00 0.99 1.3e-20 sig 8e9g-assembly1_O Mycobacterial respiratory complex I with both quinone positions modelled
1nxx-assembly1_A-2 1.00 0.85 6.4e-08 sig 1nxx-assembly1_A-2 MicArec pH 5.5
1xhf-assembly1_A 1.00 0.82 5.3e-08 sig 1xhf-assembly1_A Crystal structure of the bef3-activated receiver domain of redox response regulator arca
7m0s-assembly1_A 1.00 0.82 1.7e-07 sig 7m0s-assembly1_A N-terminal domain of PmrA from Acinetobacter baumannii
8fk2-assembly1_B 1.00 0.82 1.5e-07 sig 8fk2-assembly1_B The N-terminal VicR from Streptococcus mutans

Foldseek search of the AlphaFold DB model (mean pLDDT 88.9, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon)

Upstream (5' on genome)Rv3142c (- strand, 107 bp gap)
Downstream (3' on genome)PPE52 (- strand, 32 bp gap)

Neighbours from the H37Rv annotation (+ strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (6 TF) Rv0023 (represses) · trcR (activates) · cmtR (activates) · Rv2250c (activates) · Rv3066 (represses) · Rv3736 (represses)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: nuoJ (NADH-quinone oxidoreductase subunit J), high confidence from genomic context alone (score 999 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv3154 nuoJ exp NADH-quinone oxidoreductase subunit J 999 999 ctx cooccurence:695 experimental:997
Rv3151 nuoG exp NADH-quinone oxidoreductase subunit G 999 999 ctx cooccurence:740 experimental:997
Rv3147 nuoC exp NADH-quinone oxidoreductase subunit C 999 999 ctx cooccurence:705 experimental:997
Rv3153 nuoI exp NADH-quinone oxidoreductase subunit I 998 999 ctx cooccurence:516 experimental:997
Rv3146 nuoB exp NADH-quinone oxidoreductase subunit B 998 998 ctx neighborhood:473 experimental:997
Rv3145 nuoA exp NADH-quinone oxidoreductase subunit A 998 998 ctx neighborhood:477 experimental:997
Rv3149 nuoE exp NADH-quinone oxidoreductase subunit E 950 949 ctx cooccurence:524 experimental:870
Rv3148 nuoD exp NADH-quinone oxidoreductase subunit D 959 926 experimental:870 textmining:478
Rv3150 nuoF exp NADH-quinone oxidoreductase subunit F 922 920 experimental:870
Rv3158 nuoN exp NADH-quinone oxidoreductase subunit N 916 913 experimental:870
Rv3156 nuoL exp NADH-quinone oxidoreductase subunit L 914 911 experimental:870
Rv3157 nuoM exp NADH-quinone oxidoreductase subunit M 897 897 experimental:870
Rv3155 nuoK exp NADH-quinone oxidoreductase subunit K 901 896 experimental:870
Rv3152 nuoH exp NADH-quinone oxidoreductase subunit H 896 896 experimental:870
Rv3692 moxR2 methanol dehydrogenase transcriptional regulator MoxR 798 798 coexpression:798

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: response regulator
  • MTBC0 PGAP product: response regulator
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_217659.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0784
  • Curated reference: UniProt P9WGL7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 88.9)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 64 functional partner(s); context anchor nuoJ
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_003341|Rv3143|
MPDSSTALRILVYSDNVQTRERVMRALGKRLHPDLPDLTYVEVATGPMVIRQMDRGGIDLAILDGEATPTGGMGIAKQLKDELASCPPILVLTGRPDDTWLASWSRAEAAVPHPVDPIVLGRTVLSLLRAPAH