vapC25 Family assigned · medium auto-curated

H37Rv Rv0277c · MTBC0 mtbc0_000294 · 142 aa · 333090–333518 (-) · RefSeq NP_214791.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)ribonuclease VapC25
MTBC0 PGAP re-annotationtype II toxin-antitoxin system VapC family toxin
Revised (this work)Type II toxin-antitoxin system VapC family toxin. Pfam: PIN (PF01850.28).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WF85 SwissProt · reviewed · Evidence at protein level
UniProt nameRibonuclease VapC25
EC (curated) EC 3.1.-.-
Curated functionToxic component of a type II toxin-antitoxin (TA) system. An RNase (By similarity). Upon expression in M.smegmatis inhibits colony formation. Its toxic effect is neutralized by coexpression with cognate antitoxin VapB25.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionToxic component of a type II toxin-antitoxin (TA) system. An RNase (By similarity). Upon expression in M.smegmatis inhibits colony formation. Its toxic effect is neutralized by coexpression with cognate antitoxin
Orthologous groupCOG1848
KEGG orthology K07064
Gene Ontology (6) GO:0008150, GO:0040008, GO:0045926, GO:0048519, GO:0050789, GO:0065007

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.21 · purifying
Polymorphic sites (≥ 0.1% of strains) 10 synonymous, 6 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
PINPF01850.28 2.4e-143–133 PIN domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: vapC48 (ribonuclease VapC48), high confidence from genomic context alone (score 775 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0749 vapC31 ribonuclease VapC31 806 805 coexpression:804
Rv3697c vapC48 ribonuclease VapC48 775 775 ctx cooccurence:774
Rv0277A vapB25 Rv0277A, len: 85 aa. Possible vapB25, antitoxin,part of toxin-antitoxin (TA) operon with Rv0277c, see Arcus et al. 2005. Has in-frame stop c 873 705 ctx neighborhood:705 textmining:587
Rv0278c PE_PGRS3 PE-PGRS family protein PE_PGRS3 660 660 ctx neighborhood:660
Rv0748 vapB31 antitoxin VapB31 798 573 experimental:508 textmining:547
Rv2871 vapB43 antitoxin VapB43 526 527 experimental:508
Rv0595c vapC4 ribonuclease VapC4 879 518 ctx cooccurence:509 textmining:761
Rv2548 vapC19 ribonuclease VapC19 736 493 ctx cooccurence:489 textmining:502
Rv1720c vapC12 ribonuclease VapC12 568 489 ctx cooccurence:486
Rv0960 vapC9 ribonuclease VapC9 460 460 ctx cooccurence:452
Rv0626 vapB5 antitoxin VapB5 457 457 ctx cooccurence:440
Rv1397c vapC10 ribonuclease VapC10 665 449 ctx cooccurence:439 textmining:419
Rv3384c vapC46 ribonuclease VapC46 522 380
Rv0549c vapC3 ribonuclease VapC3 419 364
Rv0065 vapC1 ribonuclease VapC1 744 352 textmining:622

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: ribonuclease VapC25
  • MTBC0 PGAP product: type II toxin-antitoxin system VapC family toxin
  • Pfam (hmmscan --cut_ga): PIN PF01850.28 (E=2e-14)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214791.1)
  • Domains: Pfam-A via hmmscan --cut_ga — PIN (PF01850.28)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1848
  • Curated reference: UniProt P9WF85 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 31 functional partner(s); context anchor vapC48
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000294|Rv0277c|vapC25
MFLIDVNVLLAAHRGDHPNHRTVRPWFDRLLAADDPFTVPNLVWASFLRLTTNRRIFEIPSPRADAFAFVEAVNAQPHHLPTSPGPRHLVLLRKLCDEADASGDLIPDAVLGAIAVEHHCAVVSLDRDFARFASVRHIRPPI