Rv0633c Still unknown · low
H37Rv Rv0633c · MTBC0 mtbc0_000666 ·
279 aa · 732880–733719 (-) ·
RefSeq NP_215147.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | hypothetical protein |
| Revised (this work) | Conserved hypothetical; Foldseek best hit (KirBac channel, TM 0.43, 4.1A) not conclusive. Function unknown. |
Curated reference (UniProt)
| UniProt |
P96923
TrEMBL · unreviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Possible exported protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| Orthologous group | 2EM4J |
|---|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.246 · purifying |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 4 synonymous, 3 missense, 0 nonsense, 1 frameshift |
| Disruption | 1 distinct premature-stop/frameshift site(s); most common in 0.14% of strains (210) · clonal |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
No Pfam-A domain above the gathering threshold (or not yet scanned).
Structural neighbours (Foldseek on the ESMFold model, exploratory)
ESMFold model confidence: mean pLDDT 87.1 (confident). A confident model makes the fold comparison meaningful.
Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.
| Target | Prob | TM | E-value | Description |
|---|---|---|---|---|
6o9t-assembly1_A |
1.00 | 0.43 | 3.5e-03 sig | 6o9t-assembly1_A KirBac3.1 mutant at a resolution of 4.1 Angstroms |
7n9k-assembly1_A |
0.99 | 0.40 | 5.4e-03 sig | 7n9k-assembly1_A KirBac3.1 L124M mutant |
8fk7-assembly1_B |
0.97 | 0.35 | 1.8e-02 | 8fk7-assembly1_B Structure of the Pyrobaculum calidifontis flagellar-like archaeal type IV pilus |
2x6b-assembly1_A |
0.97 | 0.38 | 7.2e-03 sig | 2x6b-assembly1_A Potassium Channel from Magnetospirillum Magnetotacticum |
3ly6-assembly3_C |
0.44 | 0.33 | 1.2e-01 | 3ly6-assembly3_C Crystal structure of human transglutaminase 2 complex with adenosine 5' Triphosphate |
8gi2-assembly1_A |
0.25 | 0.26 | 1.4e-01 | 8gi2-assembly1_A Cryo-EM structure of Natrinema sp. J7-2 Type IV pilus |
6a8p-assembly3_C |
0.25 | 0.27 | 9.3e-02 | 6a8p-assembly3_C Transglutaminase 2 mutant G224V in complex with GTP |
1qun-assembly10_O |
0.23 | 0.34 | 5.3e-01 | 1qun-assembly10_O X-RAY STRUCTURE OF THE FIMC-FIMH CHAPERONE ADHESIN COMPLEX FROM UROPATHOGENIC E.COLI |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: echA3 (enoyl-CoA hydratase EchA3), high confidence from genomic context alone (score 818 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0632c echA3 |
enoyl-CoA hydratase EchA3 | 817 | 818 ctx | neighborhood:815 |
Rv0634c |
glyoxalase II | 539 | 539 ctx | neighborhood:535 |
Rv0634A hyp |
hypothetical protein | 437 | 437 ctx | neighborhood:430 |
Rv0760c hyp |
hypothetical protein | 871 | 49 | textmining:870 |
Rv2168c |
Rv2168c, (MTV021.01c), len: 108 aa. Putative transposase for IS6110 (fragment), identical to many other Mycobacterium tuberculosis IS6110 tr | 870 | 47 | textmining:870 |
Rv2286c hyp |
hypothetical protein | 870 | 47 | textmining:870 |
Rv0759c hyp |
hypothetical protein | 844 | 47 | textmining:844 |
Rv0840c pip |
proline iminopeptidase | 653 | 42 | textmining:653 |
Rv0795 |
Rv0795, (MTV042.05), len: 108 aa. Putative transposase for IS6110 (fragment), identical to Q50686 insertion element IS6110 (108 aa), FASTA s | 627 | 42 | textmining:627 |
Rv2169c |
transmembrane protein | 806 | 41 | textmining:806 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- MTBC0 PGAP product: hypothetical protein
- Foldseek best: 6o9t-assembly1_A KirBac3.1 mutant at a resolution of 4.1 Angstroms (prob 1.00, E=3e-03, TM=0.43)
- (structure-only promotion reviewed by hand, 2026-06-01)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215147.1)
- Domains: Pfam-A via hmmscan --cut_ga — none above threshold
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
2EM4J - Curated reference: UniProt P96923 (TrEMBL, unreviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Model confidence: ESMFold per-residue pLDDT (mean 87.1, confident)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
10 functional partner(s); context anchor
echA3 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>mtbc0_000666|Rv0633c| MVDSMGWVLSSWHEVTGVDSGTWLAWAAWAALGLGVVALVVTKRQIQRNRRLAAEQTRPYVAMFMEPHVADWHVIELVVRNFGRTAAYDVRFSFPNPPTVAQYENAANGYADVVELRLPQELPMLAPGQEWRMVWDSALDRAEIGRGIESRFPGTVTYYDRPEQPRRWRFWRRGRRPLETKVVLDWDALPPVARIELMTTHDLAKREKQKLELLRSLLTYFHYASKETRPDVFRSEIDRINRAAAETQDRWRARQVEVPTEVSQRSEGQGPQPTRIPAG