pra Family assigned · medium auto-curated

H37Rv Rv1078 · MTBC0 mtbc0_001158 · 240 aa · 1211582–1212304 (+) · RefSeq NP_215594.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationRDD family protein
Revised (this work)RDD family protein. Pfam: RDD (PF06271.19).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WIM7 SwissProt · reviewed · Evidence at protein level
UniProt nameProline-rich antigen homolog

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
Preferred namepra
eggNOG descriptionpfam rdd
Orthologous groupCOG1714
Gene Ontology (9) GO:0005575, GO:0005576, GO:0005618, GO:0005623, GO:0005886, GO:0016020, GO:0030312, GO:0044464, GO:0071944

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.346 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
RDDPF06271.19 2.0e-2189–233 RDD family

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: metB (cystathionine gamma-synthase), high confidence from genomic context alone (score 861 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv1079 metB cystathionine gamma-synthase 861 861 ctx neighborhood:835
Rv3442c rpsI 30S ribosomal protein S9 800 801 coexpression:800
Rv2220 glnA1 glutamine synthetase 777 772 coexpression:733
Rv3274c fadE25 acyl-CoA dehydrogenase 746 746 coexpression:746
Rv1077 cbs cystathionine beta-synthase 759 741 ctx neighborhood:735
Rv0733 adk adenylate kinase 739 739 coexpression:738
Rv1389 gmk guanylate kinase 733 733 coexpression:733
Rv0636 hadB (3R)-hydroxyacyl-ACP dehydratase subunit HadB 732 732 coexpression:732
Rv1076 lipU lipase LipU 661 661 ctx neighborhood:659
Rv0977 PE_PGRS16 PE-PGRS family protein PE_PGRS16 574 575 ctx cooccurence:567
Rv0872c PE_PGRS15 PE-PGRS family protein PE_PGRS15 552 552 ctx cooccurence:552
Rv1651c PE_PGRS30 PE-PGRS family protein PE_PGRS30 511 511 ctx cooccurence:511
Rv2853 PE_PGRS48 PE-PGRS family protein PE_PGRS48 504 504 ctx cooccurence:504
Rv0124 PE_PGRS2 PE-PGRS family protein PE_PGRS2 504 504 ctx cooccurence:504
Rv3350c PPE56 PPE family protein PPE56 489 489 ctx cooccurence:487

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: hypothetical protein
  • MTBC0 PGAP product: RDD family protein
  • Pfam (hmmscan --cut_ga): RDD PF06271.19 (E=2e-21)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_215594.1)
  • Domains: Pfam-A via hmmscan --cut_ga — RDD (PF06271.19)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1714
  • Curated reference: UniProt P9WIM7 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 56 functional partner(s); context anchor metB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_001158|Rv1078|pra
MTEQPPPGGSYPPPPPPPGPSGGHEPPPAAPPGGSGYAPPPPPSSGSGYPPPPPPPGGGAYPPPPPSAGGYAPPPPGPAIRTMPTESYTPWITRVLAAFIDWAPYVVLVGIGWVIMLVTQTSSCVTSISEYDVGQFCVSQPSMIGQLVQWLLSVGGLAYLVWNYGYRQGTTGSSIGKSVLKFKVVSETTGQPIGFGMSVVRQLAHFIDAIICFVGFLFPLWDAKRQTLADKIMTTVCVPI