nadD Resolved · high auto-curated

H37Rv Rv2421c · MTBC0 - · 211 aa · 2718173–2718808 (-) · RefSeq NP_216937.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)nicotinate-nucleotide adenylyltransferase
MTBC0 PGAP re-annotation
Revised (this work)Nicotinate-nucleotide adenylyltransferase. Pfam: CTP_transf_like (PF01467.33).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WJJ5 SwissProt · reviewed · Evidence at protein level
UniProt nameProbable nicotinate-nucleotide adenylyltransferase
EC (curated) EC 2.7.7.18
Curated functionCatalyzes the reversible adenylation of nicotinate mononucleotide (NaMN) to nicotinic acid adenine dinucleotide (NaAD).

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category H Coenzyme transport and metabolism
Preferred namenadD
eggNOG descriptionCatalyzes the reversible adenylation of nicotinate mononucleotide (NaMN) to nicotinic acid adenine dinucleotide (NaAD)
Orthologous groupCOG1057
EC number EC 2.7.7.18
KEGG orthology K00969
KEGG pathways map00760, map01100
KEGG modules M00115
Gene Ontology (65) GO:0000309, GO:0003674, GO:0003824, GO:0004515, GO:0006082, GO:0006139, GO:0006520, GO:0006531, GO:0006725, GO:0006732, GO:0006733, GO:0006753 +53 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.506 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
CTP_transf_likePF01467.33 5.1e-291–166 Cytidylyltransferase-like

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: gpgP (glucosyl-3-phosphoglycerate phosphatase), high confidence from genomic context alone (score 910 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2420c rsfS hyp hypothetical protein 976 969 ctx neighborhood:882 coexpression:676
Rv1901 cinA competence damage-inducible protein CinA 978 935 database:900 textmining:687
Rv2438c nadE glutamine-dependent NAD(+) synthetase 997 934 database:900 textmining:965
Rv1695 ppnK inorganic polyphosphate/ATP-NAD kinase 948 932 database:900
Rv1151c cobB NAD-dependent protein deacylase 947 915 database:900 textmining:408
Rv2419c gpgP glucosyl-3-phosphoglycerate phosphatase 910 910 ctx neighborhood:882
Rv1330c pncB1 nicotinic acid phosphoribosyltransferase PncB1 979 909 database:900 textmining:780
Rv0573c pncB2 nicotinic acid phosphoribosyltransferase PncB2 952 909 database:900 textmining:493
Rv1596 nadC nicotinate-nucleotide pyrophosphatase 979 908 database:900 textmining:790
Rv0155 pntAa NAD(P) transhydrogenase subunit alpha PntAa 908 903 database:900
Rv3199c nudC NADH pyrophosphatase 933 901 database:900
Rv0156 pntAb NAD(P) transhydrogenase subunit alpha PntAb 907 901 database:900
Rv0157 pntB NAD(P) transhydrogenase subunit beta PntB 906 901 database:900
Rv2713 sthA pyridine nucleotide transhydrogenase 904 901 database:900
Rv0212c nadR transcriptional regulator NadR 970 900 database:900 textmining:714

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): nicotinate-nucleotide adenylyltransferase
  • Pfam (hmmscan --cut_ga): CTP_transf_like PF01467.33 (E=5e-29)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216937.1)
  • Domains: Pfam-A via hmmscan --cut_ga — CTP_transf_like (PF01467.33)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG1057
  • Curated reference: UniProt P9WJJ5 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 64 functional partner(s); context anchor gpgP
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv2421c|nadD
MGGTFDPIHYGHLVAASEVADLFDLDEVVFVPSGQPWQKGRQVSAAEHRYLMTVIATASNPRFSVSRVDIDRGGPTYTKDTLADLHALHPDSELYFTTGADALASIMSWQGWEELFELARFVGVSRPGYELRNEHITSLLGQLAKDALTLVEIPALAISSTDCRQRAEQSRPLWYLMPDGVVQYVSKCRLYCGACDAGARSTTSLAAGNGL