nadD Resolved · high auto-curated
H37Rv Rv2421c · MTBC0 - ·
211 aa ·
2718173–2718808 H37Rv
(-) ·
RefSeq NP_216937.1
Genomic neighbourhood (genome browser)
Open in full genome browser →This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | nicotinate-nucleotide adenylyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Nicotinate-nucleotide adenylyltransferase. Pfam: CTP_transf_like (PF01467.33). |
| Functional category (TubercuList) | intermediary metabolism and respiration |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
In the literature (TB corpus sweep) 10 publications
10 TB publications mention this gene. 10 publication(s) discuss this gene (10 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).
| Publication | Date |
|---|---|
| "Identification of alkaloid compounds as potent inhibitors of Mycobacterium tuberculosis NadD using computational strategies". doi:10.1016/j.compbiomed.2023.106863 | 2023 |
| In silico repurposing of a Novobiocin derivative for activity against latency associated Mycobacterium tuberculosis drug target nicotinate-nucleotide adenylyl transferase (Rv2421c). doi:10.1371/journal.pone.0259348 | 2021 |
| Potential role for Rv2026c- and Rv2421c- specific antibody responses in diagnosing active tuberculosis. doi:10.1016/j.cca.2018.09.008 | 2018 |
| Screening of Serum Biomarkers for Distinguishing between Latent and Active Tuberculosis Using Proteome Microarray. doi:10.3967/bes2018.069 | 2018 |
| Mutation in an Unannotated Protein Confers Carbapenem Resistance in Mycobacterium tuberculosis. doi:10.1128/AAC.02234-16 | 2017 |
This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.
Genomic-neighbour overlap (structural caveat) co-directional · 1 % of gene
| Neighbour | rsfS (Rv2420c, - strand) |
|---|---|
| Overlap | 4 bp, 1 % of this gene's length |
co-directional overlap: ordinary (e.g. shared stop/start codons in an operon), not the Rv2438A-type artefact P20.1, derived from GFF3 gene coordinates, 2026-08-03.
CRISPRi vulnerability
Vulnerability index -14.89 (95% CI -15.64 to -14.12). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.
Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).
Legacy record & comparison (Mycobrowser)
| Mycobrowser function | Involved in NAD biosynthesis; catalyzes the reversible adenylation of nicotinate mononucleotide [catalytic activity: ATP + nicotinate ribonucleotide = diphosphate + deamido-NAD(+)]. |
|---|---|
| Mycobrowser EC |
2.7.7.18
· agrees with the atlas
|
The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.
Orthologues (reciprocal best hits across mycobacteria)
| M. bovis |
Mb2444c
· 99.5% identity |
|---|---|
| M. leprae |
ML1454c
· 80.2% identity |
| M. marinum |
MMAR_3749
· 80.3% identity |
| M. smegmatis |
MSMEG_4581
· 76.6% identity |
| M. orygis |
RJtmp_002503
· 100.0% identity |
| M. abscessus |
MAB_1621
· 75.3% identity |
Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.
Curated reference (UniProt)
| UniProt |
P9WJJ5
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Probable nicotinate-nucleotide adenylyltransferase |
| EC (curated) |
EC 2.7.7.18
|
| Curated function | Catalyzes the reversible adenylation of nicotinate mononucleotide (NaMN) to nicotinic acid adenine dinucleotide (NaAD). |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
H Coenzyme transport and metabolism
|
|---|---|
| Preferred name | nadD |
| eggNOG description | Catalyzes the reversible adenylation of nicotinate mononucleotide (NaMN) to nicotinic acid adenine dinucleotide (NaAD) |
| Orthologous group | COG1057 |
| EC number |
EC 2.7.7.18
|
| KEGG orthology |
K00969
|
| KEGG pathways |
map00760, map01100
|
| KEGG modules |
M00115
|
| Gene Ontology (65) |
GO:0000309, GO:0003674, GO:0003824, GO:0004515, GO:0006082, GO:0006139, GO:0006520, GO:0006531, GO:0006725, GO:0006732, GO:0006733, GO:0006753 +53 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.506 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Outgroup conservation (beyond the MTBC) Bacteria
| M. canettii dN/dS (deep-divergence selection) |
0.338 (low power)
· 2 consensus substitution(s) low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable |
|---|---|
| Genus-wide presence (~53 non-MTBC Mycobacterium) |
present in 53/53 (100%) · mean identity 82.3%
· 4/4 closest MTBAP relatives conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation |
| Phylostratum (deepest detected homolog) |
MTBC-specific → Mycobacterium → Mycobacteriaceae → Corynebacteriales → Actinomycetia → Bacteria detected in 13/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 62.8% detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene |
Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.
Essentiality (transposon mutagenesis) essential
| DeJesus 2017 call | ES · essential |
|---|---|
| What the call means | essential: insertions absent across the whole ORF |
| TA sites (Himar1) | 14 in the ORF — 14 in the essential state, 0 growth-defect, 0 non-essential, 0 growth-advantage. Saturation 0.000, mean read count 0. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction. |
Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.
Proteomics (mass spectrometry) detected
| MS detection | detected in 10 of 16 independent MS datasets |
|---|---|
| Integrated abundance | 57.1 ppm · rank 1671/3519 (52.5th percentile) |
Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.
Physico-chemical properties (computed, ProtParam)
| Length | 211 aa |
|---|---|
| Molecular weight | 23.1 kDa |
| Theoretical pI | 5.16 |
| GRAVY | -0.087 (hydrophilic) |
| Aliphatic index | 87.0 |
| Aromaticity | 0.09 |
| Instability index | 36.8 (stable) |
Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
CTP_transf_like | PF01467.33 | 5.1e-29 | 1–166 | Cytidylyltransferase-like |
Experimental structures (Protein Data Bank) 6 solved
| PDB | Method | Resolution | Coverage |
|---|---|---|---|
4x0e |
X-ray diffraction | 2.41 Å | 99% |
4rpi |
X-ray diffraction | 2.417 Å | 99% |
4ybr |
X-ray diffraction | 1.65 Å | 91% |
4s1o |
X-ray diffraction | 1.84 Å | 91% |
6buv |
X-ray diffraction | 1.86 Å | 91% |
5das |
X-ray diffraction | 2.2 Å | 91% |
Experimentally solved structures mapped from the UniProt accession via PDBe/SIFTS (6 total; up to 8 shown, ranked by sequence coverage then resolution). An experimental structure is direct proof of the folded product and the strongest structural evidence — superseding the predicted ESMFold/AlphaFold models below for any covered region.
Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 85.7
| PDB hit | prob | TM-score | E-value | Description |
|---|---|---|---|---|
5das-assembly3_A |
1.00 | 0.97 | 3.2e-35 sig | 5das-assembly3_A Structure of Mycobacterium tuberculosis NadD in complex with NADP, P21212, form 2 |
4rpi-assembly2_B |
1.00 | 0.95 | 3.7e-34 sig | 4rpi-assembly2_B Crystal Structure of Nicotinate Mononucleotide Adenylyltransferase from Mycobacterium tuberculosis |
6buv-assembly1_B |
1.00 | 0.95 | 5.9e-34 sig | 6buv-assembly1_B Structure of Mycobacterium tuberculosis NadD in complex with inhibitor [(1~{R},2~{R},5~{S})-5-methyl-2-propan-2-yl-cyclohexyl] 2-[3-methyl-2-(phenoxymethyl)benzimidazol-1-yl]ethanoate |
4rpi-assembly1_A |
1.00 | 0.93 | 2.5e-34 sig | 4rpi-assembly1_A Crystal Structure of Nicotinate Mononucleotide Adenylyltransferase from Mycobacterium tuberculosis |
4rpi-assembly1_C |
1.00 | 0.94 | 6.3e-34 sig | 4rpi-assembly1_C Crystal Structure of Nicotinate Mononucleotide Adenylyltransferase from Mycobacterium tuberculosis |
Foldseek search of the AlphaFold DB model (mean pLDDT 85.7, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.
Genomic context (neighbours & predicted operon) operon of 4
| Upstream (5' on genome) | Rv2420c (- strand, -4 bp gap) |
|---|---|
| Downstream (3' on genome) | Rv2422 (+ strand, 274 bp gap) |
| Predicted operon |
Rv2418c · gpgP · Rv2420c · nadD
|
Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).
Transcriptional regulation (signed TRN: ChIP-seq + TFOE)
| Regulated by (1 TF) |
devR (represses)
|
|---|
Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.
Functional interaction network (STRING v12, guilt-by-association)
Explore full network →Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.
Closest characterised functional partner: gpgP (glucosyl-3-phosphoglycerate phosphatase), high confidence from genomic context alone (score 910 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv2420c rsfS hyp |
hypothetical protein | 976 | 969 ctx | neighborhood:882 coexpression:676 |
Rv1901 cinA exp |
competence damage-inducible protein CinA | 978 | 935 | database:900 textmining:687 |
Rv2438c nadE exp |
glutamine-dependent NAD(+) synthetase | 997 | 934 | database:900 textmining:965 |
Rv1695 ppnK exp |
inorganic polyphosphate/ATP-NAD kinase | 948 | 932 | database:900 |
Rv1151c cobB exp |
NAD-dependent protein deacylase | 947 | 915 | database:900 textmining:408 |
Rv2419c gpgP |
glucosyl-3-phosphoglycerate phosphatase | 910 | 910 ctx | neighborhood:882 |
Rv1330c pncB1 exp |
nicotinic acid phosphoribosyltransferase PncB1 | 979 | 909 | database:900 textmining:780 |
Rv0573c pncB2 exp |
nicotinic acid phosphoribosyltransferase PncB2 | 952 | 909 | database:900 textmining:493 |
Rv1596 nadC exp |
nicotinate-nucleotide pyrophosphatase | 979 | 908 | database:900 textmining:790 |
Rv0155 pntAa exp |
NAD(P) transhydrogenase subunit alpha PntAa | 908 | 903 | database:900 |
Rv3199c nudC exp |
NADH pyrophosphatase | 933 | 901 | database:900 |
Rv0156 pntAb exp |
NAD(P) transhydrogenase subunit alpha PntAb | 907 | 901 | database:900 |
Rv0157 pntB exp |
NAD(P) transhydrogenase subunit beta PntB | 906 | 901 | database:900 |
Rv2713 sthA exp |
pyridine nucleotide transhydrogenase | 904 | 901 | database:900 |
Rv0212c nadR exp |
transcriptional regulator NadR | 970 | 900 | database:900 textmining:714 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): nicotinate-nucleotide adenylyltransferase
- Pfam (hmmscan --cut_ga): CTP_transf_like PF01467.33 (E=5e-29)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216937.1)
- Domains: Pfam-A via hmmscan --cut_ga — CTP_transf_like (PF01467.33)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG1057 - Curated reference: UniProt P9WJJ5 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 85.7)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
64 functional partner(s); context anchor
gpgP - Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
- Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
- Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
- Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
- Experimental structures: PDBe/SIFTS UniProt→PDB mapping (Dana et al. 2019, doi:10.1093/nar/gky1114)
- Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
- Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
- Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
- Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv2421c|nadD MGGTFDPIHYGHLVAASEVADLFDLDEVVFVPSGQPWQKGRQVSAAEHRYLMTVIATASNPRFSVSRVDIDRGGPTYTKDTLADLHALHPDSELYFTTGADALASIMSWQGWEELFELARFVGVSRPGYELRNEHITSLLGQLAKDALTLVEIPALAISSTDCRQRAEQSRPLWYLMPDGVVQYVSKCRLYCGACDAGARSTTSLAAGNGL
Spot an error? Suggest an improvement
Found a mistake, a missing reference, or have a better functional hypothesis for nadD? Email the maintainer — the message is pre-filled with this gene's details.