Rv0455c Family assigned · low

H37Rv Rv0455c · MTBC0 mtbc0_000477 · 148 aa · 548740–549186 (-) · RefSeq NP_214969.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationDUF5078 domain-containing protein
Revised (this work)DUF5078; structure solved (PDB 8DRI, Rv0455c); fold characterised, function not established.

Curated reference (UniProt)

UniProt O53740 TrEMBL · unreviewed · Evidence at protein level
UniProt nameConserved protein

UniProt still lists this protein as Conserved protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionDomain of unknown function (DUF5078)
Orthologous group2ARRN

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF5078PF16877.11 5.1e-5433–147 Domain of unknown function (DUF5078)

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 85.0 (confident). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
8dri-assembly2_B 1.00 0.93 1.7e-15 sig 8dri-assembly2_B Structure of Rv0455c from Mycobacterium tuberculosis
7ref-assembly2_B 1.00 0.86 3.9e-10 sig 7ref-assembly2_B Structure of MS3494 from Mycobacterium smegmatis
7ohp-assembly1_b 0.02 0.23 7.0e+00 7ohp-assembly1_b Nog1-TAP associated immature ribosomal particles from S. cerevisiae after rpL25 expression shut down, population A

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: echA2 (enoyl-CoA hydratase EchA2), high confidence from genomic context alone (score 796 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0456c echA2 enoyl-CoA hydratase EchA2 796 796 ctx neighborhood:795
Rv0457c peptidase 635 636 ctx neighborhood:635
Rv0397A hyp hypothetical protein 461 461 ctx neighborhood:461
Rv0559c hyp hypothetical protein 665 73 textmining:654
Rv0338c iron-sulfur-binding reductase 662 68 textmining:653
Rv0489 gpm1 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase 443 55 textmining:435
Rv0511 hemD uroporphyrin-III C-methyltransferase 516 52 textmining:511
Rv0677c mmpS5 membrane protein MmpS5 520 50 textmining:516
Rv0676c mmpL5 transmembrane transport protein MmpL5 514 50 textmining:510
Rv0560c benzoquinone methyltransferase 434 47 textmining:431
Rv1127c ppdK pyruvate, phosphate dikinase PpdK 505 46 textmining:503
Rv1338 murI glutamate racemase 425 46 textmining:422
Rv2047c hyp hypothetical protein 657 42 textmining:657
Rv1085c hemolysin-like protein 652 41 textmining:652
Rv1432 dehydrogenase 630 41 textmining:630

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • MTBC0 PGAP product: DUF5078 domain-containing protein
  • Pfam: DUF5078 PF16877.11
  • Foldseek best: 8dri-assembly2_B Structure of Rv0455c from Mycobacterium tuberculosis (prob 1.00, E=2e-15, TM=0.93)
  • (structure-only promotion reviewed by hand, 2026-06-01)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214969.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF5078 (PF16877.11)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2ARRN
  • Curated reference: UniProt O53740 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 85.0, confident)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 15 functional partner(s); context anchor echA2
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000477|Rv0455c|
MSRLSSILRAGAAFLVLGIAAATFPQSAAADSTEDFPIPRRMIATTCDAEQYLAAVRDTSPVYYQRYMIDFNNHANLQQATINKAHWFFSLSPAERRDYSEHFYNGDPLTFAWVNHMKIFFNNKGVVAKGTEVCNGYPAGDMSVWNWA