Rv0326 Family assigned · medium auto-curated
H37Rv Rv0326 · MTBC0 - ·
151 aa · 392273–392728 (+) ·
RefSeq NP_214840.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | hypothetical protein |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Contains Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19) domain(s); putative function inferred from the domain architecture. |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
O07251
TrEMBL · unreviewed
· Predicted
|
|---|---|
| UniProt name | Methyltransferase domain-containing protein |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
Q Secondary metabolites biosynthesis, transport and catabolism
|
|---|---|
| eggNOG description | Methyltransferase domain |
| Orthologous group | COG0500 |
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 1.375 · diversifying/relaxed |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 1 synonymous, 4 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Methyltransf_25 | PF13649.13 | 2.0e-10 | 2–78 | Methyltransferase domain |
Methyltransf_11 | PF08241.19 | 3.3e-09 | 2–81 | Methyltransferase domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0324 (transcriptional regulator), high confidence from genomic context alone (score 816 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0325 hyp |
hypothetical protein | 952 | 913 ctx | neighborhood:762 fusion:628 textmining:480 |
Rv0324 |
transcriptional regulator | 823 | 816 ctx | neighborhood:775 |
Rv0323c hyp |
hypothetical protein | 637 | 637 ctx | neighborhood:551 |
Rv1673c hyp |
hypothetical protein | 476 | 476 | coexpression:474 |
Rv2735c hyp |
hypothetical protein | 421 | 422 ctx | cooccurence:418 |
Rv3833 |
AraC family transcriptional regulator | 561 | 225 | textmining:457 |
Rv0327c cyp135A1 |
cytochrome P450 Cyp135A1 | 542 | 222 | textmining:436 |
Rv3433c nnr |
bifunctional ADP-dependent (S)-NAD(P)H-hydrate dehydratase/NAD(P)H-hydrate epimerase | 544 | 102 | textmining:514 |
Rv1224 tatB |
Sec-independent protein translocase protein TatB | 467 | 92 | textmining:438 |
Rv0213c |
methyltransferase | 655 | 87 | textmining:639 |
Rv2533c nusB |
N utilization substance protein B | 447 | 56 | textmining:439 |
Rv1048c hyp |
hypothetical protein | 635 | 55 | textmining:630 |
Rv1767 hyp |
hypothetical protein | 635 | 54 | textmining:630 |
Rv2531c |
amino acid decarboxylase | 516 | 54 | textmining:510 |
Rv0245 |
oxidoreductase | 642 | 51 | textmining:638 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): hypothetical protein
- Pfam (hmmscan --cut_ga): Methyltransf_25 PF13649.13 (E=2e-10), Methyltransf_11 PF08241.19 (E=3e-09)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214840.1)
- Domains: Pfam-A via hmmscan --cut_ga — Methyltransf_25 (PF13649.13), Methyltransf_11 (PF08241.19)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0500 - Curated reference: UniProt O07251 (TrEMBL, unreviewed; Predicted)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
29 functional partner(s); context anchor
Rv0324 - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0326| MVATDFSDVAVAQLRRSAQARGVSARVQPIVHDLRQPLPVKTGSIDGAFAHMALCMALSTSEIHAVVAEVGRVLRPGGKFIYTVRHTGDAHYGAGQAHGDDIFECAGFAVHFFRRELVARLATGWVLEEVHDFEEGELPRRLWRVTVTKPA