Rv2120c Family assigned · medium auto-curated

H37Rv Rv2120c · MTBC0 mtbc0_002252 · 160 aa · 2406508–2406990 (-) · RefSeq NP_216636.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)integral membrane protein
MTBC0 PGAP re-annotationglycine zipper 2TM domain-containing protein
Revised (this work)Glycine zipper 2TM domain-containing protein. Pfam: Rick_17kDa_Anti (PF05433.21).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt O33255 TrEMBL · unreviewed · Evidence at protein level
UniProt nameProbable conserved integral membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionmembrane
Orthologous groupCOG3918

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.397 · purifying
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 2 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Rick_17kDa_AntiPF05433.21 1.2e-0686–123 Glycine zipper 2TM domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: hisG (ATP phosphoribosyltransferase), high confidence from genomic context alone (score 768 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv2121c hisG ATP phosphoribosyltransferase 768 768 ctx neighborhood:765
Rv2122c hisE phosphoribosyl-ATP pyrophosphatase 682 682 ctx neighborhood:679
Rv3810 pirG cell surface protein 643 644 ctx cooccurence:642
Rv3707c hyp hypothetical protein 616 616 ctx cooccurence:616
Rv0315 beta-1,3-glucanase 520 521 ctx cooccurence:514
Rv2743c hyp hypothetical protein 513 513 ctx cooccurence:513
Rv0290 eccD3 ESX-3 secretion system protein EccD 485 485 ctx cooccurence:482
Rv3096 hyp hypothetical protein 478 478 ctx cooccurence:478
Rv3593 lpqF lipoprotein LpqF 431 431 ctx cooccurence:431
Rv1216c integral membrane protein 425 426 ctx cooccurence:422
Rv2123 PPE37 PPE family protein PPE37 781 418 ctx neighborhood:418 textmining:640
Rv1856c oxidoreductase 405 406 ctx cooccurence:405
Rv0256c PPE2 PPE family protein PPE2 509 369
Rv2356c PPE40 Rv2356c, (MTCY98.25), len: 615 aa. PPE40, Member of Mycobacterium tuberculosis PPE_family, highly similar to others e.g. Q10778|MTCY48.17|YF 520 47 textmining:517
Rv0453 PPE11 PPE family protein PPE11 548 45 textmining:547

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: integral membrane protein
  • MTBC0 PGAP product: glycine zipper 2TM domain-containing protein
  • Pfam (hmmscan --cut_ga): Rick_17kDa_Anti PF05433.21 (E=1e-06)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_216636.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Rick_17kDa_Anti (PF05433.21)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG3918
  • Curated reference: UniProt O33255 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 18 functional partner(s); context anchor hisG
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_002252|Rv2120c|
MTHVLVLLLALLIGVVAGLRSLTAPAVVSWAAFLGWINLHGTWASWMGNFVTVVIVSVLAVAELVNDKRPKTPPRTVTPVFAVRIILGAFAGAVIGTAWGYRWGGLGAGVIGAVLGTMGGYQARTRLVAARGGHDLPIALLEDSVAVLGGFAIVAAAAAL