Rv0314c Family assigned · low auto-curated

H37Rv Rv0314c · MTBC0 - · 220 aa · 382879–383541 (-) · RefSeq NP_214828.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)membrane protein
MTBC0 PGAP re-annotation
Revised (this work)Membrane protein.

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt O07241 TrEMBL · unreviewed · Evidence at protein level
UniProt namePossible conserved membrane protein

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionProtein of unknown function (DUF3060)
Orthologous group2EICH

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.481 · purifying
Polymorphic sites (≥ 0.1% of strains) 3 synonymous, 4 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
DUF3060PF11259.14 3.1e-23157–213 Protein of unknown function (DUF3060)

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0315 (beta-1,3-glucanase), high confidence from genomic context alone (score 757 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0315 beta-1,3-glucanase 757 757 ctx neighborhood:755
Rv0316 muconolactone isomerase 527 526 ctx neighborhood:522

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): membrane protein
  • Pfam (hmmscan --cut_ga): DUF3060 PF11259.14 (E=3e-23)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214828.1)
  • Domains: Pfam-A via hmmscan --cut_ga — DUF3060 (PF11259.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG 2EICH
  • Curated reference: UniProt O07241 (TrEMBL, unreviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 2 functional partner(s); context anchor Rv0315
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0314c|
MIVVWEHLCMNPEDDPEARIRELERPLADVARASELGGSQSGGYTYPPGPPPPPYSYGGPFGGPSPRSSSGNRAWWILAAVVVVGVLVLVGGIAAFSAQRLSQGNFVVLSPTPSVSRAVPTPTAQPATTLPPAGASLSVSGVNVNRTIACNDSIVSVSGMSNTVVITGHCTSLTVSGMRNSVTVDSVDTIEAAGFNNEVTYHSGSPKISNAGGSNSVQQG