aac Resolved · high auto-curated

H37Rv Rv0262c · MTBC0 - · 181 aa · 314309–314854 (-) · RefSeq NP_214776.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)aminoglycoside 2'-N-acetyltransferase
MTBC0 PGAP re-annotation
Revised (this work)Aminoglycoside 2'-N-acetyltransferase. Pfam: Acetyltransf_9 (PF13527.14), Acetyltransf_1 (PF00583.32), Acetyltransf_10 (PF13673.14).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).

Curated reference (UniProt)

UniProt P9WQG9 SwissProt · reviewed · Evidence at protein level
UniProt nameAminoglycoside 2'-N-acetyltransferase
EC (curated) EC 2.3.1.-
Curated functionMay catalyze the coenzyme A-dependent acetylation of the 2' hydroxyl or amino group of a broad spectrum of aminoglycosides and confer resistance to aminoglycosides (By similarity). In vitro assays show no significant increase of resistance to aminoglycosides, possibly due to low expression in a heterologous system.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category K Transcription
Preferred nameaac
eggNOG descriptionAminoglycoside 2'-N-acetyltransferase
Orthologous groupCOG0454
EC number EC 2.3.1.59
KEGG orthology K17840
Gene Ontology (35) GO:0003674, GO:0003824, GO:0005575, GO:0005623, GO:0005886, GO:0008080, GO:0008150, GO:0008152, GO:0009056, GO:0009987, GO:0016020, GO:0016137 +23 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS 0.517 · relaxed/neutral
Polymorphic sites (≥ 0.1% of strains) 2 synonymous, 3 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Acetyltransf_9PF13527.14 1.6e-0918–131 Acetyltransferase (GNAT) domain
Acetyltransf_1PF00583.32 1.3e-0938–131 Acetyltransferase (GNAT) family
Acetyltransf_10PF13673.14 5.5e-0545–132 Acetyltransferase (GNAT) domain

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: Rv0265c (iron ABC transporter substrate-binding lipoprotein), high confidence from genomic context alone (score 803 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0263c hyp hypothetical protein 995 967 ctx neighborhood:882 coexpression:731 textmining:860
Rv0264c hyp hypothetical protein 979 899 ctx neighborhood:865 textmining:804
Rv0265c iron ABC transporter substrate-binding lipoprotein 803 803 ctx neighborhood:765
Rv3835 hyp hypothetical protein 691 692 ctx cooccurence:690
Rv0202c mmpL11 transmembrane transport protein MmpL11 651 652 ctx cooccurence:648
Rv1101c hyp hypothetical protein 610 610 ctx cooccurence:609
Rv3909 hyp hypothetical protein 594 594 ctx cooccurence:593
Rv0261c narK3 nitrate/nitrite transporter 593 594 ctx neighborhood:513
Rv1024 membrane protein 588 589 ctx cooccurence:585
Rv2164c hyp hypothetical protein 560 561 ctx cooccurence:558
Rv0538 membrane protein 554 555 ctx cooccurence:550
Rv1648 transmembrane protein 550 550 ctx cooccurence:549
Rv0007 membrane protein 549 549 ctx cooccurence:547
Rv2843 hyp hypothetical protein 526 527 ctx cooccurence:524
Rv0259c hyp hypothetical protein 514 514

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): aminoglycoside 2'-N-acetyltransferase
  • Pfam (hmmscan --cut_ga): Acetyltransf_9 PF13527.14 (E=2e-09), Acetyltransf_1 PF00583.32 (E=1e-09), Acetyltransf_10 PF13673.14 (E=6e-05)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214776.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Acetyltransf_9 (PF13527.14), Acetyltransf_1 (PF00583.32), Acetyltransf_10 (PF13673.14)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0454
  • Curated reference: UniProt P9WQG9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 36 functional partner(s); context anchor Rv0265c
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>H37Rv|Rv0262c|aac
MHTQVHTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTLGGMHALIWHHGAIIAHAAVIQRRLIYRGNALRCGYVEGVAVRADWRGQRLVSALLDAVEQVMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGTVFVLPIDISLDTSAELMCDWRAGDVW