aac Resolved · high auto-curated
H37Rv Rv0262c · MTBC0 - ·
181 aa · 314309–314854 (-) ·
RefSeq NP_214776.1
Annotation: from legacy to revised
| Legacy (H37Rv / Mycobrowser) | aminoglycoside 2'-N-acetyltransferase |
|---|---|
| MTBC0 PGAP re-annotation | — |
| Revised (this work) | Aminoglycoside 2'-N-acetyltransferase. Pfam: Acetyltransf_9 (PF13527.14), Acetyltransf_1 (PF00583.32), Acetyltransf_10 (PF13673.14). |
Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.
Annotated on the H37Rv protein: this gene has no 1:1 ancestral MTBC0 anchor (PE/PPE, paralogue, IS element, or otherwise unanchored CDS).
Curated reference (UniProt)
| UniProt |
P9WQG9
SwissProt · reviewed
· Evidence at protein level
|
|---|---|
| UniProt name | Aminoglycoside 2'-N-acetyltransferase |
| EC (curated) |
EC 2.3.1.-
|
| Curated function | May catalyze the coenzyme A-dependent acetylation of the 2' hydroxyl or amino group of a broad spectrum of aminoglycosides and confer resistance to aminoglycosides (By similarity). In vitro assays show no significant increase of resistance to aminoglycosides, possibly due to low expression in a heterologous system. |
Functional vocabulary (eggNOG-mapper, orthology transfer)
| COG category |
K Transcription
|
|---|---|
| Preferred name | aac |
| eggNOG description | Aminoglycoside 2'-N-acetyltransferase |
| Orthologous group | COG0454 |
| EC number |
EC 2.3.1.59
|
| KEGG orthology |
K17840
|
| Gene Ontology (35) |
GO:0003674, GO:0003824, GO:0005575, GO:0005623, GO:0005886, GO:0008080, GO:0008150, GO:0008152, GO:0009056, GO:0009987, GO:0016020, GO:0016137 +23 more
|
Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.
Conservation & selection (intra-MTBC, 145 209 strains)
| pN/pS | 0.517 · relaxed/neutral |
|---|---|
| Polymorphic sites (≥ 0.1% of strains) | 2 synonymous, 3 missense, 0 nonsense, 0 frameshift |
pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.
Domains (Pfam, hmmscan --cut_ga)
| Pfam | Accession | i-Evalue | Residues | Description |
|---|---|---|---|---|
Acetyltransf_9 | PF13527.14 | 1.6e-09 | 18–131 | Acetyltransferase (GNAT) domain |
Acetyltransf_1 | PF00583.32 | 1.3e-09 | 38–131 | Acetyltransferase (GNAT) family |
Acetyltransf_10 | PF13673.14 | 5.5e-05 | 45–132 | Acetyltransferase (GNAT) domain |
Functional interaction network (STRING v12, guilt-by-association)
Closest characterised functional partner: Rv0265c (iron ABC transporter substrate-binding lipoprotein), high confidence from genomic context alone (score 803 excluding text-mining).
| Partner | Product | Score | No text-mining | Channels (≥400) |
|---|---|---|---|---|
Rv0263c hyp |
hypothetical protein | 995 | 967 ctx | neighborhood:882 coexpression:731 textmining:860 |
Rv0264c hyp |
hypothetical protein | 979 | 899 ctx | neighborhood:865 textmining:804 |
Rv0265c |
iron ABC transporter substrate-binding lipoprotein | 803 | 803 ctx | neighborhood:765 |
Rv3835 hyp |
hypothetical protein | 691 | 692 ctx | cooccurence:690 |
Rv0202c mmpL11 |
transmembrane transport protein MmpL11 | 651 | 652 ctx | cooccurence:648 |
Rv1101c hyp |
hypothetical protein | 610 | 610 ctx | cooccurence:609 |
Rv3909 hyp |
hypothetical protein | 594 | 594 ctx | cooccurence:593 |
Rv0261c narK3 |
nitrate/nitrite transporter | 593 | 594 ctx | neighborhood:513 |
Rv1024 |
membrane protein | 588 | 589 ctx | cooccurence:585 |
Rv2164c hyp |
hypothetical protein | 560 | 561 ctx | cooccurence:558 |
Rv0538 |
membrane protein | 554 | 555 ctx | cooccurence:550 |
Rv1648 |
transmembrane protein | 550 | 550 ctx | cooccurence:549 |
Rv0007 |
membrane protein | 549 | 549 ctx | cooccurence:547 |
Rv2843 hyp |
hypothetical protein | 526 | 527 ctx | cooccurence:524 |
Rv0259c hyp |
hypothetical protein | 514 | 514 |
STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.
Evidence
- Annotation from H37Rv (no MTBC0 1:1 anchor; H37Rv protein used): aminoglycoside 2'-N-acetyltransferase
- Pfam (hmmscan --cut_ga): Acetyltransf_9 PF13527.14 (E=2e-09), Acetyltransf_1 PF00583.32 (E=1e-09), Acetyltransf_10 PF13673.14 (E=6e-05)
- (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)
Sources
- Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
- Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214776.1)
- Domains: Pfam-A via hmmscan --cut_ga — Acetyltransf_9 (PF13527.14), Acetyltransf_1 (PF00583.32), Acetyltransf_10 (PF13673.14)
- Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
- Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021,
doi:10.1093/molbev/msab293), eggNOG 5.0 DB
(Huerta-Cepas et al. 2019) — OG
COG0454 - Curated reference: UniProt P9WQG9 (SwissProt, reviewed; Evidence at protein level)
- Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
- Interaction network: STRING v12.0 (Szklarczyk et al. 2023,
doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 —
36 functional partner(s); context anchor
Rv0265c - Primary literature: none located yet; annotation rests on the domain/homology sources above.
Ancestral MTBC0 protein sequence
>H37Rv|Rv0262c|aac MHTQVHTARLVHTADLDSETRQDIRQMVTGAFAGDFTETDWEHTLGGMHALIWHHGAIIAHAAVIQRRLIYRGNALRCGYVEGVAVRADWRGQRLVSALLDAVEQVMRGAYQLGALSSSARARRLYASRGWLPWHGPTSVLAPTGPVRTPDDDGTVFVLPIDISLDTSAELMCDWRAGDVW