trmB Resolved · high auto-curated

H37Rv Rv0208c · MTBC0 mtbc0_000222 · 263 aa · 248467–249258 MTBC0 (-) · RefSeq NP_214722.1

Genomic neighbourhood (genome browser)

Open in full genome browser →

This gene (outlined) in its genomic context; arrows are neighbouring genes coloured by verdict. Click any gene to navigate. Pan and zoom in the full browser.

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)tRNA (guanine-N(7)-)-methyltransferase
MTBC0 PGAP re-annotationtRNA (guanosine(46)-N7)-methyltransferase TrmB
Revised (this work)TRNA (guanosine(46)-N7)-methyltransferase TrmB. Pfam: Methyltransf_4 (PF02390.24).
Functional category (TubercuList)intermediary metabolism and respiration

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

In the literature (TB corpus sweep) 1 publication

1 TB publication mentions this gene. 1 publication(s) discuss this gene (0 in a M. tuberculosis context, 1 in other mycobacteria — M. smegmatis (1)).

PublicationDate
The Two-Component Locus MSMEG_0244/0246 Together With MSMEG_0243 Affects Biofilm Assembly in M. smegmatis Correlating With Changes in Phosphatidylinositol Mannosides Acylation. doi:10.3389/fmicb.2020.570606 2020

This layer CITES the literature and adds context; it does not change the verdict or the function stated elsewhere in this fiche. This distinguishes a gene that is dark because nobody has looked from one that is dark despite having been studied. Source: PubMed (whole): H37Rv locus tag + GENE NAME + ortholog identifiers (Mb…, MMAR_…, MSMEG_…, ML…, MAB_…), under a mycobacterial context filter; hits verified against the abstract text. Species-context counts distinguish M. tuberculosis literature from literature on other mycobacteria. phase76/phase77, 2026-07-13.

Conditional expression context (iModulons)

Member of 1 independently-modulated gene set(s): SigH (sigH).

iModulon membership (independently-modulated gene sets from a 647-sample RNA-seq compendium): the conditional co-expression context. Co-expression is a regulatory context, NOT a molecular function. Source: iModulonDB / modulome_mtb (Yoo 2022).

CRISPRi vulnerability

Vulnerability index 0.96 (95% CI -0.60 to 3.45). A more negative index = more vulnerable to knockdown (better drug-target quality); indicative threshold VI ≤ -6 = highly vulnerable.

Quantitative CRISPRi knockdown, graded (finer than binary Tn-seq essentiality). Source: CRISPRi vulnerability index (Bosch 2021, pebble.rockefeller.edu).

Legacy record & comparison (Mycobrowser)

Mycobrowser functionCauses methylation
Mycobrowser EC 2.1.1.33 · agrees with the atlas

The legacy Mycobrowser record is shown for verification. Mycobrowser is no longer maintained; its EC numbers predate recent nomenclature revisions, so a class change usually reflects re-numbering, not a conflict.

Orthologues (reciprocal best hits across mycobacteria)

M. bovis Mb0214c · 100.0% identity
M. leprae ML2622c · 67.0% identity
M. marinum MMAR_0448 · 64.9% identity
M. smegmatis MSMEG_0252 · 65.5% identity
M. orygis RJtmp_000223 · 100.0% identity
M. abscessus MAB_4506 · 56.7% identity

Reciprocal-best-hit orthologues (DIAMOND) against the Mycobrowser reference proteomes. A missing species is informative: e.g. a gene absent from M. leprae was likely lost in its reductive genome evolution. Locus tags link to Mycobrowser.

Curated reference (UniProt)

UniProt P9WFY9 SwissProt · reviewed · Evidence at protein level
UniProt nametRNA
EC (curated) EC 2.1.1.33
Curated functionCatalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred nametrmB
eggNOG descriptionCatalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA
Orthologous groupCOG0220
EC number EC 2.1.1.33
KEGG orthology K03439
Gene Ontology (56) GO:0001510, GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0006139, GO:0006396, GO:0006399, GO:0006400, GO:0006725 +44 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.30% of strains (430) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Outgroup conservation (beyond the MTBC) Bacteria

M. canettii dN/dS (deep-divergence selection) 0.0 (low power) · 2 consensus substitution(s)
low power (2 canettii-consensus substitution(s)); present in M. canettii but dN/dS not reliable
Genus-wide presence (~53 non-MTBC Mycobacterium) present in 53/53 (100%) · mean identity 66.6% · 4/4 closest MTBAP relatives
conserved across the genus (present in 53/53 non-MTBC Mycobacterium genomes, incl. distant relatives) — an ancient core gene predating the genus radiation
Phylostratum (deepest detected homolog) MTBC-specific Mycobacterium Mycobacteriaceae Corynebacteriales Actinomycetia Bacteria
detected in 12/13 non-Mycobacterium reference genomes (down to Bacteria) · mean identity 46.2%
detected down to outside the phylum (Proteobacteria/Firmicutes controls) — a universally conserved, ancient bacterial gene

Two orthogonal outgroup signals. M. canettii (the immediate outgroup) gives a deep-divergence dN/dS (a low value confirms a constrained, real gene; shown as confident only at ≥8 substitutions, else flagged low-power). Genus-wide presence/absence (tblastn vs assembled non-MTBC genomes) places the gene on the ancient-core ↔ MTBC-specific axis: a gene absent even from the closest MTBAP relatives is a candidate MTBC-specific innovation (possible host-adaptation factor, to confirm by synteny). The phylostratum extends that axis outside the genus (tblastn vs 13 reference genomes spanning Mycobacteriaceae → Corynebacteriales → Actinomycetia → outside the phylum): it is the deepest clade in which a homolog is still detected, i.e. a proxy for gene age. Read it with the null model in mind: a shallow (young) stratum can also reflect homology-detection failure for short or fast-evolving ORFs, so it is a descriptive axis, not a proof of novelty.

Essentiality (transposon mutagenesis)

DeJesus 2017 callNE · non-essential
What the call meansnon-essential
TA sites (Himar1) 12 in the ORF — 0 in the essential state, 0 growth-defect, 12 non-essential, 0 growth-advantage. Saturation 1.000, mean read count 81.8333333333. A region of the protein devoid of TA sites is invisible to this assay: nothing can be inferred about it, in either direction.

Genome-wide Himar1 transposon essentiality in H37Rv (DeJesus 2017). An essential call (ES/ESD/GD) is strong, independent evidence that a "hypothetical" locus encodes a functional, selectively required gene — orthogonal to intra-species conservation.

Mutant phenotypes (conditional Tn-seq, MtbTnDB) in-vivo phenotype

Conditionlog2FCqEffect
fitness in mouse infection (in vivo) +3.610.0 disruption advantageous
fitness in mouse infection (in vivo) +3.460.0016 disruption advantageous
fitness in mouse infection (in vivo) +2.580.042 disruption advantageous
Mutants exhibiting altered fitness in the absence of gene marP (other) -2.230.0 required
altered fitness under 3 weeks hypoxia (stress) +1.220.013 disruption advantageous

Conditional fitness of transposon-disruption mutants across 5 significant condition(s) (|log2FC|≥1, q≤0.05), from the standardized MtbTnDB compendium. A negative log2FC means the mutant is depleted — the gene contributes to fitness in that condition. An in-vivo defect for a "hypothetical" is strong evidence it matters for infection, even without a known molecular function. Disruption (Tn insertion), not a clean deletion; genetic-interaction screens excluded.

Proteomics (mass spectrometry) detected

MS detectiondetected in 10 of 16 independent MS datasets
Integrated abundance55.6 ppm · rank 1686/3519 (52.1th percentile)

Detection by mass spectrometry is direct, experimental evidence that the protein product exists — orthogonal to sequence conservation and to Tn-seq essentiality, and especially decisive for a "hypothetical" locus. Reproducible detection across several independent datasets (PaxDb) makes the existence claim robust; the integrated abundance places the protein in the proteome's dynamic range.

Physico-chemical properties (computed, ProtParam)

Length263 aa
Molecular weight28.5 kDa
Theoretical pI9.43
GRAVY-0.16 (hydrophilic)
Aliphatic index98.7
Aromaticity0.042
Instability index46.6 (unstable)

Computed from the ancestral MTBC0 sequence with the ExPASy ProtParam method (Biopython). Descriptive biophysical context: a positive GRAVY flags a hydrophobic (often membrane) protein, a high instability index (>40) predicts a short in-vitro half-life, an extreme pI hints at compartment or binding partner.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Methyltransf_4PF02390.24 1.6e-5576–247 Putative methyltransferase

Structural search (AlphaFold DB model, Foldseek vs PDB — genome-wide) pLDDT 83.3

PDB hitprobTM-scoreE-valueDescription
3dxz-assembly1_A 1.00 0.90 7.6e-23 sig 3dxz-assembly1_A Crystal structure of EcTrmB in complex with SAH
3dxy-assembly1_A 1.00 0.87 3.3e-23 sig 3dxy-assembly1_A Crystal structure of EcTrmB in complex with SAM
1yzh-assembly1_A 1.00 0.81 9.9e-18 sig 1yzh-assembly1_A Crystal Structure of the Conserved Hypothetical Protein, Methyltransferase from Streptococcus pneumoniae TIGR4
7nzj-assembly3_E 1.00 0.80 6.6e-16 sig 7nzj-assembly3_E Structure of bsTrmB apo
8cti-assembly1_A 1.00 0.80 2.6e-14 sig 8cti-assembly1_A Cryo-EM structure of human METTL1-WDR4-tRNA(Val) complex

Foldseek search of the AlphaFold DB model (mean pLDDT 83.3, gated at 70) against the PDB — a genome-wide extension of the ESMFold dark-gene search that also covers proteins beyond the single-sequence length limit. Confident structural neighbours (E < 0.01) shown.

Genomic context (neighbours & predicted operon) operon of 2

Upstream (5' on genome)Rv0207c (- strand, 2 bp gap)
Downstream (3' on genome)Rv0209 (+ strand, 131 bp gap)
Predicted operon Rv0207c · Rv0208c

Neighbours from the H37Rv annotation (- strand). The operon is predicted by co-directional intergenic distance (same strand, gaps ≤50 bp) — a transcription-unit hypothesis, not a mapped TSS. For a "hypothetical", co-transcription with a characterised operon is a concrete functional lead (complements the STRING neighborhood channel below).

Transcriptional regulation (signed TRN: ChIP-seq + TFOE)

Regulated by (6 TF) Rv0081 (activates) · Rv0767c (represses) · trcR (activates) · Rv1776c (activates) · Rv1990c (represses) · mtrA (activates)

Regulatory edges from the ISB signed transcriptional regulatory network (TF ChIP-seq binding, Minch 2015 + TF-overexpression response, Rustad 2014). An edge is regulatory evidence (binding and/or expression change), not necessarily direct. For a "hypothetical", membership in a known regulon (e.g. DosR dormancy, PhoP virulence) is a strong physiological-context lead.

Functional interaction network (STRING v12, guilt-by-association)

Explore full network →

Node colour = verdict, dashed = hypothetical; edge colour = evidence (green experimental, orange genomic-context, grey co-expression), width ∝ score. Click a partner to open its page; "Explore full network" to walk the graph.

Closest characterised functional partner: mmpL3 (transmembrane transport protein MmpL3), high confidence from genomic context alone (score 837 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0207c hyp hypothetical protein 989 973 ctx neighborhood:882 coexpression:783 textmining:604
Rv2118c trmI exp tRNA (adenine(58)-N(1))-methyltransferase 886 859 coexpression:643 database:540
Rv0206c mmpL3 transmembrane transport protein MmpL3 862 837 ctx neighborhood:798
Rv0210 hyp hypothetical protein 801 801 ctx neighborhood:775
Rv0209 hyp hypothetical protein 776 776 ctx neighborhood:775
Rv2793c truB tRNA pseudouridine synthase B 817 758 coexpression:648
Rv0722 rpmD 50S ribosomal protein L30 650 651 coexpression:650
Rv1407 fmu 16S rRNA m5C967 methyltransferase 747 645 coexpression:425
Rv0823c dusB tRNA-dihydrouridine synthase 657 579
Rv3455c truA tRNA pseudouridine synthase A 657 550 coexpression:400
Rv3834c serS exp serine--tRNA ligase 547 519 experimental:490
Rv1340 rphA ribonuclease PH 527 498
Rv1112 ychF GTP-binding protein 504 494 coexpression:402
Rv2963 integral membrane protein 484 485 coexpression:483
Rv3396c guaA GMP synthase 478 478 coexpression:409

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The exp badge marks an experimentally-supported partner (measured interaction, experimental/database channel ≥400) as opposed to a purely predicted one — but note that the M. tuberculosis experimental interactome is dominated by a noisy bacterial-two-hybrid screen, so a strong measured link that contradicts the operon/localisation context is likely a false positive. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: tRNA (guanine-N(7)-)-methyltransferase
  • MTBC0 PGAP product: tRNA (guanosine(46)-N7)-methyltransferase TrmB
  • Pfam (hmmscan --cut_ga): Methyltransf_4 PF02390.24 (E=2e-55)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214722.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Methyltransf_4 (PF02390.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0220
  • Curated reference: UniProt P9WFY9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Genome-wide structure: AlphaFold DB model (Jumper et al. 2021, doi:10.1038/s41586-021-03819-2; Varadi et al. 2024, doi:10.1093/nar/gkad1011) searched vs PDB with Foldseek (mean pLDDT 83.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 57 functional partner(s); context anchor mmpL3
  • Essentiality: genome-wide transposon mutagenesis in H37Rv — DeJesus et al. 2017 (mBio, doi:10.1128/mBio.02133-16, CC BY)
  • Proteomics: integrated mass-spectrometry abundance from PaxDb 5.0 (Huang et al. 2023, doi:10.1016/j.mcpro.2023.100640), taxon 83332 — weighted average of 16 datasets, incl. Schubert et al. 2013 (doi:10.1016/j.chom.2013.04.008) and Albrethsen et al. 2013 (doi:10.1074/mcp.M112.018846)
  • Functional category: TubercuList scheme (Cole et al. 1998, doi:10.1038/31159), via Mycobrowser (Kapopoulou et al. 2011, doi:10.1016/j.tube.2010.09.006)
  • Orthologues: reciprocal best hits (DIAMOND, Buchfink et al. 2021, doi:10.1038/s41592-021-01101-x) against Mycobrowser release 5 reference proteomes
  • Genomic context / operon: H37Rv annotation; operon predicted by co-directional intergenic distance (Salgado et al. 2000, doi:10.1073/pnas.030539397)
  • Transcriptional regulation: ISB signed TRN — TF ChIP-seq (Minch et al. 2015, doi:10.1038/ncomms6829) + TF overexpression (Rustad et al. 2014, doi:10.1186/gb-2014-15-11-502)
  • Mutant phenotypes: standardized Tn-seq compendium MtbTnDB (Jinich et al. 2025, doi:10.1111/mmi.15370), aggregating many primary Tn-seq studies across conditions
  • Physico-chemical properties: ExPASy ProtParam method via Biopython (Gasteiger et al. 2005), computed from the MTBC0 sequence
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000222|Rv0208c|trmB
MVHHGQMHAQPGVGLRPDTPVASGQLPSTSIRSRRSGISKAQRETWERLWPELGLLALPQSPRGTPVDTRAWFGRDAPVVLEIGSGSGTSTLAMAKAEPHVDVIAVDVYRRGLAQLLCAIDKVGSDGINIRLILGNAVDVLQHLIAPDSLCGVRVFFPDPWPKARHHKRRLLQPATMALIADRLVPSGVLHAATDHPGYAEHIAAAGDAEPRLVRVDPDTELLPISVVRPATKYERKAQLGGGAVIELLWKKHGCSERDLKIR