trmB Resolved · high auto-curated

H37Rv Rv0208c · MTBC0 mtbc0_000222 · 263 aa · 248467–249258 (-) · RefSeq NP_214722.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)tRNA (guanine-N(7)-)-methyltransferase
MTBC0 PGAP re-annotationtRNA (guanosine(46)-N7)-methyltransferase TrmB
Revised (this work)TRNA (guanosine(46)-N7)-methyltransferase TrmB. Pfam: Methyltransf_4 (PF02390.24).

Auto-curated: this verdict and function were generated by rules from PGAP + Pfam + Foldseek and have not been hand-reviewed.

Curated reference (UniProt)

UniProt P9WFY9 SwissProt · reviewed · Evidence at protein level
UniProt nametRNA
EC (curated) EC 2.1.1.33
Curated functionCatalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category J Translation, ribosomal structure and biogenesis
Preferred nametrmB
eggNOG descriptionCatalyzes the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA
Orthologous groupCOG0220
EC number EC 2.1.1.33
KEGG orthology K03439
Gene Ontology (56) GO:0001510, GO:0003674, GO:0003824, GO:0005575, GO:0005622, GO:0005623, GO:0005737, GO:0006139, GO:0006396, GO:0006399, GO:0006400, GO:0006725 +44 more

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 1 missense, 0 nonsense, 1 frameshift
Disruption 1 distinct premature-stop/frameshift site(s); most common in 0.30% of strains (430) · clonal

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

PfamAccessioni-EvalueResiduesDescription
Methyltransf_4PF02390.24 1.6e-5576–247 Putative methyltransferase

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: mmpL3 (transmembrane transport protein MmpL3), high confidence from genomic context alone (score 837 excluding text-mining).

PartnerProductScoreNo text-miningChannels (≥400)
Rv0207c hyp hypothetical protein 989 973 ctx neighborhood:882 coexpression:783 textmining:604
Rv2118c trmI tRNA (adenine(58)-N(1))-methyltransferase 886 859 coexpression:643 database:540
Rv0206c mmpL3 transmembrane transport protein MmpL3 862 837 ctx neighborhood:798
Rv0210 hyp hypothetical protein 801 801 ctx neighborhood:775
Rv0209 hyp hypothetical protein 776 776 ctx neighborhood:775
Rv2793c truB tRNA pseudouridine synthase B 817 758 coexpression:648
Rv0722 rpmD 50S ribosomal protein L30 650 651 coexpression:650
Rv1407 fmu 16S rRNA m5C967 methyltransferase 747 645 coexpression:425
Rv0823c dusB tRNA-dihydrouridine synthase 657 579
Rv3455c truA tRNA pseudouridine synthase A 657 550 coexpression:400
Rv3834c serS serine--tRNA ligase 547 519 experimental:490
Rv1340 rphA ribonuclease PH 527 498
Rv1112 ychF GTP-binding protein 504 494 coexpression:402
Rv2963 integral membrane protein 484 485 coexpression:483
Rv3396c guaA GMP synthase 478 478 coexpression:409

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Legacy H37Rv annotation: tRNA (guanine-N(7)-)-methyltransferase
  • MTBC0 PGAP product: tRNA (guanosine(46)-N7)-methyltransferase TrmB
  • Pfam (hmmscan --cut_ga): Methyltransf_4 PF02390.24 (E=2e-55)
  • (auto-curated by rules from PGAP + Pfam + Foldseek; not hand-reviewed)

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214722.1)
  • Domains: Pfam-A via hmmscan --cut_ga — Methyltransf_4 (PF02390.24)
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0220
  • Curated reference: UniProt P9WFY9 (SwissProt, reviewed; Evidence at protein level)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 57 functional partner(s); context anchor mmpL3
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000222|Rv0208c|trmB
MVHHGQMHAQPGVGLRPDTPVASGQLPSTSIRSRRSGISKAQRETWERLWPELGLLALPQSPRGTPVDTRAWFGRDAPVVLEIGSGSGTSTLAMAKAEPHVDVIAVDVYRRGLAQLLCAIDKVGSDGINIRLILGNAVDVLQHLIAPDSLCGVRVFFPDPWPKARHHKRRLLQPATMALIADRLVPSGVLHAATDHPGYAEHIAAAGDAEPRLVRVDPDTELLPISVVRPATKYERKAQLGGGAVIELLWKKHGCSERDLKIR