Rv0209 Family assigned · medium

H37Rv Rv0209 · MTBC0 mtbc0_000223 · 361 aa · 249390–250475 (+) · RefSeq NP_214723.1

Annotation: from legacy to revised

Legacy (H37Rv / Mycobrowser)hypothetical protein
MTBC0 PGAP re-annotationhypothetical protein
Revised (this work)IniC/dynamin-like protein (isoniazid-induced, iniBAC-family large GTPase-like). RefSeq leaves it 'hypothetical protein'. Distinct locus from iniC/Rv0342.

Curated reference (UniProt)

UniProt P96391 TrEMBL · unreviewed · Predicted
UniProt nameUncharacterized protein

UniProt still lists this protein as Uncharacterized protein; the revised annotation above is ahead of the current UniProt record.

Functional vocabulary (eggNOG-mapper, orthology transfer)

COG category S Function unknown
eggNOG descriptionATPase. Has a role at an early stage in the morphogenesis of the spore coat
Orthologous groupCOG0699

Orthology-based transfer (eggNOG 5.0.2, diamond). EC/KO/GO/CAZy are computed annotations, not manual curation; cross-check against the primary literature before treating a specific reaction as established.

Conservation & selection (intra-MTBC, 145 209 strains)

pN/pS n/a
Polymorphic sites (≥ 0.1% of strains) 0 synonymous, 9 missense, 0 nonsense, 0 frameshift

pN/pS from segregating SNPs (singletons removed) normalised by possible sites. Low pN/pS = purifying selection (a strong signal that a "hypothetical" is a real, constrained gene). A high pN/pS is ambiguous: relaxed constraint or positive selection (drug resistance, antigenic variation) inflate it; e.g. rpoB/katG/pncA score high here for resistance, not loss of function. A clonal disruption (one allele over a clade) suggests lineage pseudogenisation; a convergent one (many independent alleles) is typical of resistance loss-of-function.

Domains (Pfam, hmmscan --cut_ga)

No Pfam-A domain above the gathering threshold (or not yet scanned).

Structural neighbours (Foldseek on the ESMFold model, exploratory)

ESMFold model confidence: mean pLDDT 94.9 (very high). A confident model makes the fold comparison meaningful.

Best matches against the PDB, ranked by Foldseek homology probability. A high probability / TM-score suggests a shared fold; unless flagged sig (E < 0.01) these are fold hypotheses, not assignments.

TargetProbTME-valueDescription
8xqp-assembly1_A 1.00 0.42 2.0e-02 8xqp-assembly1_A Structure of human class T GPCR TAS2R14-Gustducin complex with Aristolochic acid A.
7uxh-assembly1_d 0.98 0.46 1.1e-01 7uxh-assembly1_d cryo-EM structure of the mTORC1-TFEB-Rag-Ragulator complex
1u0r-assembly1_C 0.54 0.44 9.1e-01 1u0r-assembly1_C Crystal structure of Mycobacterium tuberculosis NAD kinase
6y2k-assembly1_A 0.28 0.34 1.2e+00 6y2k-assembly1_A Crystal structure of beta-galactosidase from the psychrophilic Marinomonas ef1
7kqa-assembly1_B 0.23 0.24 3.9e-01 7kqa-assembly1_B Crystal Structure of Glucosamine-6-phosphate deanimase from Strenotrophomonas maltophilia
7z0t-assembly1_G 0.15 0.23 5.2e-01 7z0t-assembly1_G Structure of the Escherichia coli formate hydrogenlyase complex (aerobic preparation, composite structure)
3hba-assembly1_A 0.12 0.20 5.0e-01 3hba-assembly1_A Crystal structure of a putative phosphosugar isomerase (sden_2705) from shewanella denitrificans os217 at 2.00 A resolution
3odp-assembly1_A-2 0.08 0.19 1.0e+00 3odp-assembly1_A-2 Crystal structure of a putative tagatose-6-phosphate ketose/aldose isomerase (NT01CX_0292) from CLOSTRIDIUM NOVYI NT at 2.35 A resolution

Functional interaction network (STRING v12, guilt-by-association)

Closest characterised functional partner: trmB (tRNA (guanine-N(7)-)-methyltransferase), high confidence from genomic context alone (score 776 excluding text-mining). This association is the citable seed of a function hypothesis for this hypothetical protein.

PartnerProductScoreNo text-miningChannels (≥400)
Rv0210 hyp hypothetical protein 976 976 ctx neighborhood:882 coexpression:806
Rv0208c trmB tRNA (guanine-N(7)-)-methyltransferase 776 776 ctx neighborhood:775
Rv0207c hyp hypothetical protein 730 730 ctx neighborhood:729
Rv0211 pckA phosphoenolpyruvate carboxykinase 714 715 ctx neighborhood:713
Rv0206c mmpL3 transmembrane transport protein MmpL3 487 487 ctx neighborhood:485

STRING combines evidence channels (neighborhood, fusion, cooccurrence, coexpression, experimental, database, text-mining) into a 0–1000 score. The ctx badge marks edges carried by the genomic-context channels (conserved neighborhood, fusion, phylogenetic co-occurrence), which are independent of orthology and structure and the strongest signal for an unknown gene. The no text-mining column recomputes the score from data alone, so a link that does not depend on the literature is visible. Association is a function hypothesis, not proof: corroborate with the operon context and the primary literature before assigning a function.

Evidence

  • Foldseek vs AFDB-SwissProt: isoniazid-induced protein IniC, TM 0.59, E 5e-9
  • Structural homology vs AlphaFold-Swiss-Prot (Foldseek; 542k curated SwissProt structures), project 'Still unknown gene function' phase13, 2026-06-10. Fold/family-level, not a demonstrated function.

ESM Atlas signal (exploratory)

Ancestral protein hash 2b56ed1c2ea89436672f44b8e5b410ac · 10 ESM-space neighbours (max similarity 0.935). SAE features are orienting indices, not validated domains.

#IndexActivationInterpretation
113341 1.24 P-loop GTPase G4 guanine-recognition subdomain
22174 1.22 P-loop GTPase coupling helix
35138 1.18 Canonical P-loop GTPase G-domain
44409 1.12 G-domain Walker A P-loop
511953 0.99 GTPase-flanking coiled-coil scaffolds
68885 0.87 Coiled-coil machine head domains
71243 0.84 P-loop NTPase Walker A/B
810126 0.82 Nucleotide-binding beta strand/loop

Sources

  • Ancestral sequence & coordinates: Harrison LB et al. (2024), An imputed ancestral reference genome for the MTBC, doi:10.1101/2023.09.07.556366
  • Product annotation: NCBI PGAP on MTBC0; legacy from H37Rv NC_000962.3 (RefSeq NP_214723.1)
  • Domains: Pfam-A via hmmscan --cut_ga — none above threshold
  • Sequence-level signal: ESM Atlas (EvolutionaryScale × BioHub) — exploratory
  • Controlled vocabulary: eggNOG-mapper 2.1.12 (Cantalapiedra et al. 2021, doi:10.1093/molbev/msab293), eggNOG 5.0 DB (Huerta-Cepas et al. 2019) — OG COG0699
  • Curated reference: UniProt P96391 (TrEMBL, unreviewed; Predicted)
  • Intra-MTBC selection: pN/pS and disruption from SPDI variants of 145 209 MTBC strains (this work, local collection vs H37Rv NC_000962.3)
  • Model confidence: ESMFold per-residue pLDDT (mean 94.9, very high)
  • Interaction network: STRING v12.0 (Szklarczyk et al. 2023, doi:10.1093/nar/gkac1000), taxon 83332, CC-BY 4.0 — 5 functional partner(s); context anchor trmB
  • Primary literature: none located yet; annotation rests on the domain/homology sources above.

Ancestral MTBC0 protein sequence

>mtbc0_000223|Rv0209|
MRGQGHQIFVDELARFATSSADQRVVAIAQRAAEPLRVAVRGRPGVGCRTVARALQGAGSSSGMTVTPQARAADSDVDLVVYVTVEVVKPEDREAIAATRRPVVAVLNKADLAGPLSGAGPIVMAQARCAQFSTLLGVPMESMIGLLAVAALDDLDDTLRAALRALAAHPDGFDALDRAVAGFLAAALPVPTEVRLRLLDTLDLFGIALGMAAFRPGRPSRTPAQLRTLLRRVSGVDAVIDKVTAAGSEVRYRRLLDAVAELEALAAQAKEIGGPIGEFLRDDDTVLARMAAAVDVALAVGLDVGPLDDPAAHLPRAVRWHRYSLDNGDMHRTCGADIARGSLRLWSLAGGMPLHRYRKSS